KEGG   Gossypium raimondii: 105769275Help
Entry
105769275         CDS       T04129                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
gra  Gossypium raimondii
Pathway
gra00052  Galactose metabolism
gra00500  Starch and sucrose metabolism
gra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    105769275
   00500 Starch and sucrose metabolism
    105769275
Enzymes [BR:gra01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     105769275
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 105769275
NCBI-ProteinID: XP_012445251
UniProt: A0A0D2RYR3
LinkDB All DBs
Position
9
AA seq 906 aa AA seqDB search
MNTTQKKDLLHHLLLFFIIFSATSSYLAVVHGVNEAVGYGYKLKSVSVDPEQKWLAADLS
LIRNSSVYGPDIQNLNLFVSFETSDRLRIRVTDSGHQRWEIPQEIIPRQSQNPFSLGSPA
NYQTRKLMETRSVSDPTSDLIFTLQNTTPFGFTVKRRSSGDTLFDASPDPSDPRTFLVFK
EQYIQLSSALPENRSSLYGLGEHTKRSFKLQHDDTLTLWNADLASANLDFNLYGSHPFYI
DVRSASGSGRIAAGTSHGVLLFNSNGMDIVYGANRITYKVIGGIIDLYVFGGPLPHTVVQ
QYTELIGRPAPMPYWSFGFHQCRYGYKNVSDLEGVVAGYAKANIPLEVMWTDIDYMDGFK
DFTLDPVNFPEDKMKQLVDKLHRNGQKYVVIIDPGISVNSSYGSYIRGMQADIFIKRDGI
PYLGEVWPGRVYFPDFVNPQTLTYWGGEIKLFRDILPVDGLWLDMNEVSNFITSPPTPNS
ALDDPPYKINNQGIQRPINNKTVPATALHFGNLTEYDVHNLYGLLECKATHAALTNLTGK
RPFILSRSTFVSSGKYTAHWTGDNAATWEDLAYTIPSILNFGLFGIPMVGADICGFSGNT
TEELCRRWIQLGAFYPFARDHSELHSIRQELYIWDSVAATARKVLGLRYRLLPYFYTLMY
EAHTKGTPIARPLFFTFPQDVHTYEINSQFLVGKGIMVSPALHPGVVSVDAYFPTGNWFD
LFNYSNSVSATSGKYFTLAAPPDHINVHVREGNIIAMQGEAMTTKAARETPFQLLVAVSN
TENITGELFLDDGEAVEMGEGGGKWSFVRFHGADSGDSVSVRSEVENGEYALSQKWMINK
VTFVGLEKRRRVKGYELSPGNTRILNGKPILKPKLGKDAQFQVVEITRLMLPVGEEFNLQ
LKTPQS
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atgaatacaacacaaaaaaaggacttgctacatcatcttttattgttttttattatcttt
tctgctacttcttcttacttggccgttgttcatggggttaatgaagcagttggttatggc
tacaaactgaaatctgtttccgttgacccggagcaaaaatggttggccgccgatctttct
cttatccgcaactcctctgtttatggacctgatattcaaaatctcaatcttttcgtcagc
ttcgagacaagcgatcgtttgagaatcagagttacagattcagggcatcaaagatgggaa
atcccacaagaaattattcctcgtcaatcccaaaatcctttcagcctcggctcaccagca
aactaccagacacggaagctaatggaaacacgctcggtgtcggacccaacatcggacctc
attttcactctccaaaacaccacaccattcgggttcacggtgaaacgccgatcctccggc
gacacccttttcgacgcatcaccggacccatcggacccacgcactttcttggtgttcaag
gaacaatacatccaactctcctcggcgctgcctgaaaacaggtcgtctctgtacggactc
ggggaacacacgaagagatcgttcaagttacaacacgacgacacgttgacgttatggaat
gcggatttagcgagtgctaatcttgacttcaatctttatggatcgcatcccttttacatt
gacgtaagatcagcatctggtagtggcagaattgcggcaggaactagccatggagtattg
ttgtttaatagcaacggaatggacatagtctatggagcaaaccggataacttacaaggtc
attggaggtattatagacttgtatgtttttggtggaccattgccccacaccgtcgtgcag
cagtatactgaacttattggccgccctgctcccatgccttattggtccttcggattccat
cagtgccgatatggttacaaaaacgtttctgacctcgagggtgtggttgctggctacgcc
aaagctaacatccctctggaagttatgtggacggacatcgattacatggatggatttaag
gacttcactcttgaccccgtcaacttcccggaggacaagatgaaacaactcgtcgataag
cttcatcggaatggtcaaaaatatgtggtcatcatagatcccggtatcagtgtaaacagt
tcatatggaagctacatcagagggatgcaagctgatatattcataaaaagagatggcatc
ccttatttgggtgaagtttggcctggtcgagtctactttccagattttgtaaaccctcaa
acactaacatattggggtggtgagatcaagttgtttcgagacattctccctgttgatggt
ctttggctcgacatgaatgaggtatccaacttcataacatcccctccaacgccaaattca
gccttggatgatcctccttacaagatcaacaaccagggaattcaacgacccattaataac
aaaacagttcctgcaactgctctgcattttggtaacctgacagaatacgatgttcataac
ctgtatggtttactggaatgcaaagcaactcatgcggcattgaccaatctgaccggcaaa
cgcccatttatacttagcagatcaacgtttgtaagctctgggaaatatacagcacactgg
actggtgacaatgcagccacctgggaggatttggcttatacaattccatccattttgaac
ttcggactctttggaattccaatggttggcgctgatatatgcggcttttcggggaatacc
actgaagagctgtgcaggcgatggattcaactaggggcattttaccctttcgctagagat
cactcggagcttcattcaatccggcaagagctctatatctgggattcagtggctgccaca
gctaggaaagtgctgggcctccggtaccgcctgttgccatacttttacaccctaatgtac
gaggcacacacgaaagggactcccattgcaaggcctctgttcttcacattccctcaagat
gttcacacttacgaaatcaattcacagtttctggtaggtaaaggtataatggtttcacct
gcattacatccgggagtagtttcagtcgatgcttatttcccgacaggaaactggttcgac
ctcttcaattactccaactcagtgagcgcaacatccgggaaatacttcacactcgctgca
ccacctgatcatataaacgttcatgtccgagaaggaaacatcatagccatgcaaggagag
gcaatgacgacgaaagccgctcgggaaacgccgttccaactcctggtggccgtcagcaac
acggagaacatcactggggaactattcttggacgacggagaggcagtggagatgggagaa
ggtgggggaaagtggagttttgtgagatttcatggagcagattccggtgatagcgtatct
gttagatcggaggttgagaatggagagtatgctttgagtcaaaaatggatgataaataaa
gtgacattcgtggggttggaaaaaaggaggagggtgaaggggtatgagttaagccctgga
aacacaagaattttgaatggaaagccaattttgaagccaaaattaggcaaggatgcccaa
ttccaagttgtggagataacaagactgatgctacctgtcggagaggagttcaatttgcaa
ctcaaaactccccaaagttag

DBGET integrated database retrieval system