KEGG   Gossypium raimondii: 105770725Help
Entry
105770725         CDS       T04129                                 

Definition
(RefSeq) long chain acyl-CoA synthetase 9, chloroplastic-like
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
gra  Gossypium raimondii
Pathway
gra00061  Fatty acid biosynthesis
gra00071  Fatty acid degradation
gra01100  Metabolic pathways
gra01212  Fatty acid metabolism
gra04146  Peroxisome
Module
gra_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:gra00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    105770725
   00071 Fatty acid degradation
    105770725
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    105770725
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:gra01004]
    105770725
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gra04147]
    105770725
Enzymes [BR:gra01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     105770725
Lipid biosynthesis proteins [BR:gra01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   105770725
Exosome [BR:gra04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   105770725
  Exosomal proteins of breast cancer cells
   105770725
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 105770725
NCBI-ProteinID: XP_012447500
UniProt: A0A0D2QMH1
LinkDB All DBs
Position
9
AA seq 691 aa AA seqDB search
MNGYIVGAIVPIVLVLLRNSKRVKKRGVLVDVGGEPGYAIRNIRFPFPLETAWEGLSTLA
ELFEQSCKQNSNKSLLGTRKLISSEVEVTEDGRSFEKLHYGEYVWLTYAETFAAVCYFAS
GLVQLGHKRGERVAIFADTREEWFIALQACFRRNVTVVTIYASLGEEALCHSLNETEVTT
LICGAKELKKLVNISGQLDKIKHVICMDDEIPTAVSGRWAVTSFADVQRTGYENPVDADL
PIAADVAVIMYTSGSTGLPKGVMLTHGNILATVAAVKTIIPGIGSKDVYLAYLPLAHILE
LAAEHLIVAVGGILGYGSPLTLTDTSSKKKPGTKGDASVLAPTLMAAVPAILDRVRDGVR
KKVDAKGGLSKKLFDLAYSRRLSAINGSWFGAWGLEKYLWDLLVFKKVRAILGGRLRFLL
SGGAPLSPDTQRFINICFGTPIGQGYGLTETCAGGTFSEVDDTSVGRVGAPLPCSFIKLV
DWPKGGYLTSNSPMPRGEILIGGPNVTLGYFKNEEKTKESYRVDERGVRWFCTGDIGQFH
SDGCLEIIDRKKDIVKLQHGEYVSLGKVETALSICPYVDNIMLHADPFHSFCVALVVASQ
QMVEDWASKQGITFTDFADLCEKEETIKEVHSSLAQTAKKSRLEKFEIPAKIKLISSPWT
PESGLVTAALKIKREAIRRAFSEDLAKLYAS
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgaatggttatattgttggtgcgattgtccccattgttcttgtgctccttcgaaattca
aagagggtgaagaagcgaggagtgctggttgatgttggtggggaacctgggtacgcaatc
cgaaacattcggtttccattccctctagaaacagcatgggaaggtttatctacacttgca
gaactttttgagcagtcatgtaagcagaacagcaataaaagcttgcttggcactaggaaa
ctgatttcgagtgaggttgaagtaactgaagatggaagatcctttgagaagcttcattat
ggagaatatgtatggttgacatatgctgaaacatttgcagctgtgtgctattttgcttct
ggtttagttcaacttggtcataaaaggggagaacgcgtggcaatctttgctgatacaaga
gaagaatggttcattgcattgcaggcctgctttaggcgcaatgtcactgtggtgacaata
tatgcatctttgggggaggaggctttatgtcactcattaaatgagactgaagttacaaca
ctgatttgcggggccaaagaattaaaaaagcttgtcaacattagtggccaactcgacaag
ataaaacatgtgatctgtatggatgatgagattccaactgctgtaagtggtagatgggca
gtcacttcttttgctgatgtccagagaaccggctatgaaaatcctgttgatgctgattta
cctattgcagctgatgttgcagttataatgtatactagtggaagtactggattgcctaag
ggtgttatgctgacacatggcaatatactagctaccgttgctgcagtcaagacaattatt
cctggaattggaagcaaagatgtctatcttgcgtatctaccccttgctcatattcttgaa
ttagcggctgagcatttaattgttgctgtaggaggtatcctaggatatggatcccctttg
actcttactgatacatctagcaagaaaaaaccaggaacaaagggggatgcctccgtgtta
gctccaaccctgatggcagctgttccagcaattcttgatcgtgttcgagatggagtacga
aagaaggtagatgcaaaaggtggactatccaagaaattgtttgacttggcgtattctcgt
agattatctgcaataaatggtagttggtttggtgcctggggccttgaaaagtatctgtgg
gacttactcgtctttaagaaggtccgagcaattctaggtggtcgccttcgatttttgctt
tctggaggtgctcctctatcaccagatactcagagatttatcaacatctgctttggtact
ccaattggccaagggtatggtctaactgagacttgtgctggtggcaccttctctgaggtt
gatgatacatctgttggtcgcgttggtgctccacttccttgctcctttattaagttagta
gactggcctaaaggtggatatttaactagtaattcaccaatgcctcgtggagaaatactg
atcggtggtccgaatgtgacgcttggatacttcaaaaatgaagaaaaaacaaaagaatca
tatagggttgatgagagaggagttaggtggttctgtacaggtgacataggacagtttcat
tccgatggttgccttgagataattgaccgtaaaaaagacattgtcaaacttcagcatgga
gaatatgtctctttaggaaaggttgagactgctctcagtatctgtccctatgtcgacaat
attatgttgcatgctgatccatttcacagtttttgtgtggctctcgtggtggcttcccaa
caaatggtggaagattgggcttcaaagcaaggcattacatttactgattttgcagacttg
tgtgagaaagaagaaactatcaaggaagtacattcctctcttgctcagacagccaagaag
tcacgattggagaagtttgagattcctgcaaaaatcaaattgatttctagtccatggact
ccagaatcagggcttgtgactgcagctctcaagatcaagagagaggccattagaagagct
ttttctgaagacctggccaagctatatgcatcatag

DBGET integrated database retrieval system