KEGG   Gossypium raimondii: 105773101Help
Entry
105773101         CDS       T04129                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASHH3
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
gra  Gossypium raimondii
Pathway
gra00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:gra00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    105773101
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gra03036]
    105773101
Enzymes [BR:gra01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     105773101
Chromosome and associated proteins [BR:gra03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     105773101
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET DUF682
Motif
Other DBs
NCBI-GeneID: 105773101
NCBI-ProteinID: XP_012450214
UniProt: A0A0D2VDH2
LinkDB All DBs
Position
10
AA seq 365 aa AA seqDB search
MPATKKSSDCSHIGYAFNKLMKQIGHPVEFELPDCFNKWKDTPYTVIRRNIYLTKRIKRR
LEDDGIFCSCTSSSPGSSVCGRDCHCGMLLSSCSSGCSCGSSCLNKPFQHRPVKKLKLIK
TEKCGEGIVADEDIKHGEFVIEYVGEVIDDKTCEERLWNMKHRGETNFYLCEINRDMVID
ATYKGNKSRYINHSCCPNTEMQKWIIDGETRIGIFAMRDIKKGEHLTYDYQFVQFGADQD
CHCGAAGCRQKLGVKPSKSKMSSDATLKLVACQVAVSSPTLKAVLFGNENGGLPVGTSQH
DYNQRQLRFRCCIGEVIKISRPINDSYFGIIKRFDKYSKKHLVMFEDGDVEFLDLSKEDW
EIITL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctacaaagaagagttctgattgcagtcacattggctatgcattcaacaagttg
atgaagcaaattggacatccggttgagtttgaactgccagattgctttaataagtggaaa
gacacgccatacaccgttataaggcgcaacatatatctcacaaagaggattaaaaggcgc
ctggaggatgatggaattttctgttcttgcacatcatcatcacctggttcttctgtgtgt
ggcagagattgccactgtgggatgctactgtctagttgctcttctggctgcagctgtggg
agttcatgcctcaataaaccattccaacacagacctgtcaaaaaactgaaattgattaag
accgagaaatgtggagagggcattgtagctgatgaagatatcaagcatggagagtttgta
atagaatatgtcggggaagttattgatgacaaaacatgtgaggagaggctttggaacatg
aagcatcgtggagaaaccaatttctacttatgtgaaatcaatcgtgatatggtaattgat
gccacatacaaggggaacaaatccagatatataaaccatagttgctgccccaatactgag
atgcagaaatggataattgatggtgaaacaaggattggcatatttgcaatgcgagatata
aaaaagggggagcatctgacctatgattatcagtttgttcaatttggtgcagatcaagat
tgtcactgtggtgccgctggctgcaggcaaaaacttggggtcaaacctagcaagtcaaag
atgtcatcagatgctacattaaagctagtagcatgccaagtggcagtgtcctctccaaca
ttgaaagctgttctatttggaaatgaaaatggaggtttgcctgtcggaacttctcagcat
gattataatcaacgacagttacgttttcggtgttgcattggtgaagtgataaaaatatct
cgtccaataaatgatagttactttggaattattaaacgatttgacaagtattcaaaaaag
cacctggtcatgtttgaagatggtgatgttgaatttctggatctgtcgaaagaggattgg
gagattatcactttgtaa

DBGET integrated database retrieval system