KEGG   Gossypium raimondii: 105773775Help
Entry
105773775         CDS       T04129                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial-like
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
gra  Gossypium raimondii
Pathway
gra00564  Glycerophospholipid metabolism
gra01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gra00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    105773775
Enzymes [BR:gra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     105773775
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 Pyr_redox GIDA NAD_binding_8 Lycopene_cycl HI0933_like Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 105773775
NCBI-ProteinID: XP_012451339
UniProt: A0A0D2VD05
LinkDB All DBs
Position
10
AA seq 632 aa AA seqDB search
MSATATRLRRVAAVATAVAVTACGGAVLLPPSVSSNDRGVGPVVESMRRTISDPNAIVPS
RSVQESTLIGASSTSPLDILVVGGGATGCGVALDAATRGLRVGLVEREDFSSGTSSRSTK
LIHGGVRYLEKAVFNVDYGQLKLVFHALEERKQVIENAPHLCHALPCMTPCFNWFEVVYY
WMGLKMYDLVAGRHILHLSRYYSVQESIELFPTLARKGKDKSLRGTVVYNDGQMNDSRLN
VGLACSAALAGAAVLNHAEVVSFLKDEGSERIIGAKIRDNLSGQEFETYAEVVVNAAGPF
CDSVRKMANKDAQPMICPSSGVHVVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTVAG
TTDSNTSITALPEPHEDEIQFILDAICDYLNVKVRRTDVLSAWSGIRPLAMDPTAKNTES
ISRDHVVCEDFPGLVTITGGKWTTYRSMAEDAVNAAIKSGKLSPRNECITGNLRLVGGDG
WESSSFTVLAQQYIRMKKTHGGKVVPGVMDTASAKHLSHAYGTLAERVATIAQNETLGKR
LAHGYPYLEAEVAYCARNEYCESAIDFIARRSRLAFLDTDAAGRALPRIIEILAKEHNWD
RSRRKQEMQKAREFLETFKSSKNAQFHDGKHQ
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcaaccgccactcgcctccgccgcgtcgccgccgttgctacagcggtagctgtt
actgcctgcggtggtgctgttctcttacctccgtctgtttcttccaatgaccgcggcgtt
ggccccgtcgtagagtccatgaggcggacgatcagtgatccaaacgccattgttccttcc
agaagtgtccaggaatcgactctgatcggtgccagctcgactagtccactcgacatcctg
gtcgtaggcggcggtgccaccggctgcggcgttgctctcgacgctgccactagaggcctc
cgtgtcggccttgttgagcgagaggatttctcttccggaacgtcttctcggtctacgaag
ctaattcatggaggggtccgatacttggagaaagctgtctttaacgttgactacgggcaa
ttgaagctggttttccatgcacttgaggagcgtaaacaggttattgagaatgcgcctcat
ctctgccatgccttgccatgcatgacaccttgttttaactggtttgaggtagtatactac
tggatgggcttgaaaatgtacgatttggtcgcaggacgccatatattacatttgtccaga
tattattcagtgcaagaatctattgagctcttccctactcttgcaagaaagggtaaagat
aaaagcttgaggggcacagttgtgtacaatgatgggcagatgaatgactctcgcctaaat
gttggattagcttgcagtgctgcacttgctggagcagcagtgcttaaccatgcagaagtt
gtatcatttcttaaagatgaaggttccgagaggataattggtgcaaaaattcgtgacaat
ctgtcaggccaagaattcgaaacctatgcagaagttgttgtgaatgcggctggaccattt
tgtgactctgtaaggaaaatggctaacaaggatgcacagcccatgatttgtcctagcagc
ggtgtacatgttgttctccctgattattattctcctgaaggaatgggtttgattgtccct
aaaactaaggatggacgtgttgttttcatgcttccatggttggggagaactgtagctggc
actacggattctaatacttccatcactgcacttccagaaccacatgaggatgaaatacaa
tttatacttgatgctatatgtgattatcttaacgtcaaggtacgacgcacagatgttctt
tctgcttggagtggtattcgtccattggcaatggatcctactgcaaagaacactgagagc
atctctcgagatcatgttgtttgtgaggattttcctggtttggtcacaataactggtgga
aagtggactacttatcgaagcatggcagaagatgcggtgaatgcagctatcaagtccggt
aagctaagccctaggaatgaatgtataacaggcaacctacggctggttggtggagatgga
tgggaaagctcatcttttactgtacttgctcagcagtacatacgcatgaagaagacacat
ggtgggaaagttgttccaggagtaatggacacagctagcgcaaagcatttgtctcatgct
tatgggaccttagcggaacgagtagccacaatagctcagaatgaaacactgggtaagagg
cttgcccatggttacccatatctggaggccgaggttgcatactgtgctcgaaatgagtac
tgtgaatctgctattgatttcattgccaggagatctcgccttgctttccttgacacagat
gcagcaggccgagcattgccgcgaattatcgaaatacttgctaaggagcacaattgggac
cggtccaggcggaagcaagaaatgcagaaggctagagaatttttggaaactttcaagtca
tcgaagaatgcacagttccatgacgggaaacaccagtag

DBGET integrated database retrieval system