KEGG   Gossypium raimondii: 105782431Help
Entry
105782431         CDS       T04129                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gra  Gossypium raimondii
Pathway
gra00010  Glycolysis / Gluconeogenesis
gra00020  Citrate cycle (TCA cycle)
gra00620  Pyruvate metabolism
gra01100  Metabolic pathways
gra01110  Biosynthesis of secondary metabolites
gra01200  Carbon metabolism
Module
gra_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105782431
   00020 Citrate cycle (TCA cycle)
    105782431
   00620 Pyruvate metabolism
    105782431
Enzymes [BR:gra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     105782431
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 105782431
NCBI-ProteinID: XP_012462619
UniProt: A0A0D2SAC6
LinkDB All DBs
Position
13
AA seq 537 aa AA seqDB search
MQTQLGSAAFPRLLRRSLSYIPSILYSLHSLLNLFHFFRFLSNSSPQSQKHKEMASPFLS
NTTISFSSSLSSSSLPRIAPSIPFSSIRSNSTPRRILTVRSKIREIFMPALSSTMTEGKI
VSWVKSEGDVLSKGESVVVVESDKADMDVETFYDGILAAIVVGEGETAPVGAAIGILAET
EDEIAEAKAKAASKSGASTPSAPPPAPAPGAASTPAPPKSTPAPAAPTVAEGPRKTVATP
FAKKLAKQHKVDIESVVGTGPYGRITPEDIEAAAGLSPSKKNVGLAVVVETKPAAPAKAP
AASAAPSSLPPPVPGSTVVPFTTMQAAVSKNMVESLSVPTFRVGYPVTTDALDALYEKVK
PKGVTMTALLAKAAAMALAQHPLVNSSCKDGKSFTYNSNINIAVAVAINGGLITPVLQDA
DKLDLYLLSQKWKELVEKARAKQLQPQEYNSGTFTLSNLGMFGVDRFDAILPPGQGAIMA
VGASKPTVVADADGFFSVKNKMLVNVTADHRIIYGADLAAFLQTFSKIVENPESLTL
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacacagttgggtagtgcagcatttcctcgtcttctccgccgctccctctcttat
attccctccattctctactctctccattcgctccttaatttatttcatttctttcgcttt
ctctccaattcctctcctcaaagccaaaaacacaaggaaatggcttctccctttctctct
aacactaccatctctttctcttcttccctttcttcttcttctcttcctcgtattgcccct
tcaattcctttttcttcaattcgctccaattcaaccccaagacgaatcctgaccgtccgt
tccaagatcagggagatcttcatgcctgccctcagttctaccatgaccgagggcaagatc
gtctcttgggttaaatccgaaggtgatgtactctccaaaggtgaaagcgtcgtcgttgtc
gaatccgacaaggctgacatggatgtcgagactttctacgacggcattctcgctgctata
gttgttggggaaggcgaaactgctcctgttggtgctgccattggtattctcgctgagact
gaagatgaaattgctgaggctaaagccaaagctgcctcaaaatcaggtgcttcaacccca
tctgctcctcctcctgctccagctccaggtgctgcctcaactccagctcctcccaaatcg
acgccagctcccgcggctccaacagttgcggaggggccgaggaagactgttgccacacca
tttgcaaagaagttagcgaagcagcacaaggtggacattgagtctgtggttggaacaggt
ccgtatgggaggattacgccagaggacattgaggccgccgccggtctttcgccttcgaag
aaaaatgtggggcttgcagtggttgtggaaacgaagcctgcagcaccagcgaaagctcca
gctgcttctgccgccccttctagccttcctcctccagttccaggatctacggtagtgccg
tttacgacaatgcaggctgccgtttcgaagaatatggtggagagcctttcagtgcccaca
tttcgagtggggtatcctgtgactacggacgcgcttgatgccttgtatgagaaggtgaaa
ccaaagggagtgacaatgactgctttgttagccaaagctgccgcaatggcacttgcgcag
caccctcttgtgaattcaagctgtaaagatggcaagagttttacttacaatagtaacatc
aacattgcagtagctgttgctattaatggtggcttgattacccctgttcttcaagatgca
gataagttggatttgtatctactgtctcaaaaatggaaagaattggtggagaaagcccgg
gcaaagcagcttcagcctcaagagtataattcggggacattcactctgtccaatctgggc
atgtttggagtggacaggtttgatgccattcttcccccaggccagggagctatcatggct
gttggagcatcaaagccaactgttgtagctgatgctgatggattcttcagcgtgaaaaac
aaaatgctggtgaatgttactgctgaccaccgaattatctatggtgctgatttggctgcc
ttccttcagaccttctcaaagattgttgagaaccctgaaagcctcactttgtag

DBGET integrated database retrieval system