KEGG   Gossypium raimondii: 105783109Help
Entry
105783109         CDS       T04129                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 3-like
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gra  Gossypium raimondii
Pathway
gra00010  Glycolysis / Gluconeogenesis
gra00030  Pentose phosphate pathway
gra00051  Fructose and mannose metabolism
gra00052  Galactose metabolism
gra01100  Metabolic pathways
gra01110  Biosynthesis of secondary metabolites
gra01200  Carbon metabolism
gra01230  Biosynthesis of amino acids
gra03018  RNA degradation
Module
gra_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:gra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105783109
   00030 Pentose phosphate pathway
    105783109
   00051 Fructose and mannose metabolism
    105783109
   00052 Galactose metabolism
    105783109
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    105783109
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gra01009]
    105783109
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:gra03019]
    105783109
Enzymes [BR:gra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     105783109
Protein phosphatases and associated proteins [BR:gra01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     105783109
Messenger RNA biogenesis [BR:gra03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     105783109
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-GeneID: 105783109
NCBI-ProteinID: XP_012463778
UniProt: A0A0D2W8N5
LinkDB All DBs
Position
13
AA seq 476 aa AA seqDB search
MASPALPEISKPKIVDGPGGYVLEDVPHLTDYIPDLPTYPNLLQDNPAYSVVKQYFVHVD
DSVPQKVVVHKDDPKGIHFRRAGARQKVYFHSDDVHACIVTCGGLCPGLNTVVREIVCGL
HHMYGVKKVLGIDGGYKGFYAKNTVYLNPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQ
DRGINQVYIIGGDGTQRGAALIFEEIRRRGLKVSVAGIPKTIDNDIPVIDKSFGFDTAVE
EAQRAINAAHVESESFENCIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGPG
GLFEYIEKRLKEDEHMVIVIAEGAGQELLSQSIQSTTDASGNKLLQDVGLWISQSIKDHF
SKQKMPINLKYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVNGRHTY
IPFNRIIEKQNKVVITDRMWARLLSSTNQPSFLRPSTNLLSNGNGSQKSLDKKVTH
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggcttcccctgctttgcctgagatttcaaagcctaagatcgtcgacggtcccggcggt
tatgtacttgaagatgttcctcacttaactgattatattcctgatcttcctacttatcct
aatctgttgcaagacaatccggcatactctgttgttaagcaatattttgttcacgttgat
gatagcgtccctcaaaaggttgtagttcacaaggatgatccaaaaggaattcatttccga
cgagctggagcacgtcaaaaggtatattttcattctgatgacgttcatgcatgtattgta
acgtgtggcggtctttgccctggactcaacactgtggttagagagattgtatgtggcttg
caccacatgtacggtgtaaagaaagtattggggatcgatggaggatacaaggggttttat
gcaaaaaatacagtgtatttaaatcccaaggttgttaatgatatacataaacgtggtgga
actatccttgggacatcacgaggtggacatgatacctcaaaaattgttgatagtattcag
gatcgtgggattaatcaggtttacattatcggaggagatggaactcaaagaggtgcagct
cttatattcgaggaaattagaaggcgtggtctcaaagtttcagttgccggtatccctaaa
actattgacaatgacattccggttatcgacaagtcgtttggcttcgacactgcagttgag
gaggctcaacgtgccattaacgcagctcatgttgaatctgaaagtttcgagaattgtatt
gggcttgtgaagctaatgggccgctacagtggttttattgcaatgtatgcgacattagca
agccgagatgtggattgttgcttgatcccagagtcacctttttatcttgaaggacctgga
gggctttttgaatacattgagaaacgacttaaagaagatgagcatatggtcattgtgatt
gcagaaggtgcaggccaggaactactttcccaaagcattcaatccacgacagatgcttca
ggaaacaagcttctccaggatgttgggctatggatatcacaaagtatcaaggatcacttt
tcaaaacaaaagatgcccataaacctcaaatatatagatcctacttatatgattcgtgct
gttccaagcaatgcatcggataatgtttactgtacacttctggctcaaagtgctgtccat
ggagcgatggcgggatacactggctttacaagcggacttgtcaatggcaggcacacttac
atacctttcaaccgaattatcgagaaacaaaacaaggttgtgattacagataggatgtgg
gcaaggcttctttcttcaacaaatcaacccagctttttgagaccatcaaccaacttgttg
agtaacggaaacggtagccaaaagagtttggacaaaaaggtaactcactaa

DBGET integrated database retrieval system