KEGG   Gossypium raimondii: 105783629Help
Entry
105783629         CDS       T04129                                 

Definition
(RefSeq) hexokinase-3-like
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
gra  Gossypium raimondii
Pathway
gra00010  Glycolysis / Gluconeogenesis
gra00051  Fructose and mannose metabolism
gra00052  Galactose metabolism
gra00500  Starch and sucrose metabolism
gra00520  Amino sugar and nucleotide sugar metabolism
gra01100  Metabolic pathways
gra01110  Biosynthesis of secondary metabolites
gra01200  Carbon metabolism
Module
gra_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
gra_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105783629
   00051 Fructose and mannose metabolism
    105783629
   00052 Galactose metabolism
    105783629
   00500 Starch and sucrose metabolism
    105783629
   00520 Amino sugar and nucleotide sugar metabolism
    105783629
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    105783629
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gra04131]
    105783629
Enzymes [BR:gra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     105783629
Membrane trafficking [BR:gra04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    105783629
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 105783629
NCBI-ProteinID: XP_012464653
UniProt: A0A0D2U6X4
LinkDB All DBs
Position
13
AA seq 504 aa AA seqDB search
MGKVVLGVAVGVAVAACTVAALVVGRRVRSRRKWKRVVGVLKEMEESCETTVGRLKQVVD
AMAVEMHAGLASEGGSKLKMLLTFVDNLPSGSEKGIFYALDLGGTNFRVLRVELGGQRSD
LDPDVEQQPIPEQLMTGRSEDLFDFIASSLYQFVEKNDSVQSPITKLLGFTFSFPVKQTS
VSSGVLIKWTKGFAIRDMVEKEVAGALQQALTRKGLNMRVSVLVNDTVGTLALGHYHDAD
TVAAVIIGTGTNACYWERTDAIIKCQGLLTTSGGMVVNMEWGNFWSSHLPRTSYDIELDA
ESPNPNDQGFEKMISGMYLGDIVRRVILRMSEESDVFGPVSSRLYLPFTLRTPLMAAMHE
DDSPELTQVARILKDVLDIPDIPLKARKLVVKICDVVTRRAARLAAAGIVGILKKIGRDG
SGGITGGRSRSDIKMRRTAVAVEGSLYTQYTMFREYLHEALNEILGEDIARHVVVIVTED
GSGTGAALLAASHSSENVNNIQLI
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagtggtattaggggtggcagtaggggtggcggtggcggcgtgtacggtggcg
gcgttggtagtagggaggagagtaaggagtagaaggaagtggaaaagagtggttggggtt
ttaaaagaaatggaagaaagctgtgaaacaacagttgggagattaaaacaagtggtggat
gccatggctgttgagatgcatgctggtttagcttctgaaggaggatccaaactcaaaatg
ttgctcacttttgttgataatctaccttctgggagtgagaaaggaattttttatgctcta
gatcttggaggtactaattttagggtcttacgggttgaactaggaggtcaaagatccgat
ttggatccagatgttgagcaacaacccattcccgagcagttgatgactggcagaagtgag
gacctttttgattttatagcttcatcgttgtatcaatttgtcgaaaaaaatgattctgtg
caatctccgatcacaaaactactcgggtttacattctcttttccggttaaacagacatct
gtctcgtcgggggttttaataaaatggacgaaaggattcgcaattagagacatggtcgaa
aaagaggttgctggagctttacaacaagcactgacccggaaaggtttaaatatgcgagtt
tctgtgctggtgaatgatactgttggaacattagctctcggacattatcatgatgcagac
actgttgctgcagtgataattgggacaggtacgaatgcctgctactgggaacggactgat
gctatcattaagtgccaaggacttcttacaacttccggtggcatggttgtcaatatggaa
tgggggaatttttggtcatctcatttaccaagaacttcgtatgatatcgaattggatgcc
gagagtcctaatccgaacgatcagggctttgagaaaatgatatcaggcatgtatttgggt
gacattgttaggagagtgattttaaggatgtcagaagagtcggatgtttttggaccggtt
tcttccaggttatatttgcctttcaccttaaggacaccattaatggctgcaatgcacgaa
gacgactcccccgaattaacacaagttgcaagaatcttaaaagacgttcttgatatcccg
gacattcccttgaaggccaggaagctcgtcgtgaagatatgcgacgtggtaactcggaga
gccgctcgtctggcagcagctggcatcgttgggatcttgaaaaagatcggccgggacgga
agcggtggcatcacgggcggaagaagtagaagcgatatcaagatgcgaagaacggcggtg
gcggtcgagggaagtttatacacacaatacacaatgtttcgagagtatttgcacgaagcg
ttgaacgaaatattgggagaagatattgcacggcacgttgttgttatcgtaacggaagac
gggtcggggactggagcggctctactcgcggcttcacattcatcggaaaatgtcaataac
atacaattgatataa

DBGET integrated database retrieval system