KEGG   Gossypium raimondii: 105784067Help
Entry
105784067         CDS       T04129                                 

Definition
(RefSeq) enoyl-[acyl-carrier-protein] reductase [NADH], chloroplastic-like
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
gra  Gossypium raimondii
Pathway
gra00061  Fatty acid biosynthesis
gra00780  Biotin metabolism
gra01100  Metabolic pathways
gra01212  Fatty acid metabolism
Module
gra_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:gra00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    105784067
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    105784067
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    105784067
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:gra01004]
    105784067
Enzymes [BR:gra01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     105784067
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     105784067
Lipid biosynthesis proteins [BR:gra01004]
 Fatty acid synthase
  Component type
   105784067
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-GeneID: 105784067
NCBI-ProteinID: XP_012465304
UniProt: A0A0D2VIA8
LinkDB All DBs
Position
13
AA seq 392 aa AA seqDB search
MAATVASSLQIMAARPCLSFSPGVVKAGAAILCSNPKTVLWPKLTNSCNISSLNPFRHGF
RSSTVKFIKVVTKAMSESNENRPVSGLPIDLKGKRAFIAGVADDNGYGWAIAKSLAASGA
EILVGTWVPALNIFETSLRRGKFNESRLLPDGSLMEITKVYPLDAVFDNLDDVPEDIKTN
KRYAGSSKWTVQEVAESVKQDFGSIDILVHSLANGPEVSKPLLETSRKGYLAALSASSYS
YVSLLKHFLPLMNPGGSSISLTYIASERIIPGYGGGMSSAKAALESDTRVLAFEAGRKHK
IRVNAISAGPLRSRAAKAIGFIDMMIEYSKANAPLQKELSADEVGNTAAFLASPLASAIT
GAVIYVDNGLNAMGIGVDSCIFKDLNIPSDKH
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaacagtagcttccagcctacaaataatggcagcaagaccctgtctttcattt
tctcctggggttgttaaagcaggtgctgccattctatgttcgaatcccaaaacggtgttg
tggccgaagctaacaaattcgtgcaatatatcatctttaaaccctttccgacacggtttc
agatcatccacagtaaagtttatcaaggttgtaacgaaagcaatgtctgaatctaatgaa
aataggcctgtttccgggttgccaattgacttgaaaggtaagagggcatttattgccggt
gtagccgatgacaatggatatggctgggcaatagcaaaatctcttgctgcttcaggcgct
gaaatactagtcggaacatgggtgcctgctttgaacatattcgaaaccagcttgcgacgg
ggaaagttcaatgaatcacgcttattgccggatggctctttaatggagattaccaaagta
tatcctctagatgcagtctttgacaacctcgatgatgtacccgaagatattaaaacgaat
aagcgttatgccggatcctcaaagtggaccgttcaggaagttgctgaatccgttaaacag
gatttcggaagcattgacattctcgtgcattcactagccaatggccccgaggtcagcaaa
cctcttttggagacatcccggaaaggataccttgcggctttatctgcttcaagttactcc
tatgtttccttactcaaacattttctccccttaatgaatccaggaggttcttcaatttct
cttacgtacattgcttctgagcgaataattccaggatatggcggaggtatgagttctgct
aaagcagctctcgaaagtgacacaagagtacttgctttcgaagcaggaagaaaacataaa
atccgggtcaacgcaatatccgctggccctctaagaagtcgtgctgcgaaagcaattgga
tttattgacatgatgatcgaatactcgaaggccaatgcacctctccaaaaagaactatct
gcagatgaagtggggaatactgctgctttcttggcatctccattggcttcggctatcacg
ggtgccgtcatatatgttgataacggtttgaatgcaatgggtatcggagttgacagttgc
atatttaaagacctcaacattccgagcgacaagcactag

DBGET integrated database retrieval system