KEGG   Gossypium raimondii: 105785601Help
Entry
105785601         CDS       T04129                                 

Definition
(RefSeq) glutamate decarboxylase-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
gra  Gossypium raimondii
Pathway
gra00250  Alanine, aspartate and glutamate metabolism
gra00410  beta-Alanine metabolism
gra00430  Taurine and hypotaurine metabolism
gra00650  Butanoate metabolism
gra01100  Metabolic pathways
gra01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    105785601
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    105785601
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    105785601
   00430 Taurine and hypotaurine metabolism
    105785601
Enzymes [BR:gra01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     105785601
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 105785601
NCBI-ProteinID: XP_012467166
UniProt: A0A0D2R7N6
LinkDB All DBs
Position
2
AA seq 498 aa AA seqDB search
MVLSKTASQSDVSVHSTFASRYVRDQLPRFRMPENSIPKDAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECNKLIMDAINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGDSETAVG
VGTVGSSEAIMLAGLAFKRKWQNKRKAEGKPYDKPNIVTGANVQVCWEKFARYFEVELKE
VKLREGYYVMDPAKAVEMVDENTICVAAILGSTLNGEFEDVKLLNDLLVEKNKETGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRNKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGYEGYRNIMENCHENAMVLKEGLEK
TGRFNIVSKDEGVPLVAFSLKDNKRHDEFEISEMLRRFGWIVPAYTMPADAQHITVLRVV
IREDFSRTLAERLVIDIQKVLHELDTLPAKVNAKLAMAEEENSKNGTVKKTAIETQREIT
SYWKKFVSERKTNKNKIC
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggtgctatccaagacagcttctcaatctgatgtctcagttcactccacttttgcctct
cgttatgtccgagaccaacttcctaggttcaggatgccagagaactcaataccaaaagac
gctgcatatcagatcatcaacgatgaactgatgcttgatgggaacccgaggttgaacctt
gcctcttttgtcactacctggatggagcctgaatgtaataagcttattatggatgccatt
aacaagaactatgtcgacatggatgagtaccctgtcaccaccgagcttcagaatcggtgt
gtgaacatgatagcacatttgttcaatgcaccacttggggactcggagactgccgttgga
gtgggaaccgttggttcatccgaggcaatcatgttggctggccttgccttcaagaggaag
tggcaaaacaagcgtaaagctgaaggcaaaccatatgacaagcccaacatcgtaaccgga
gccaatgttcaagtgtgctgggagaaattcgccagatactttgaagtggagttgaaggaa
gtgaagctaagggaaggttactatgtcatggaccctgccaaagctgtggaaatggttgat
gaaaacaccatctgtgtagcagccatattgggttcaaccctcaatggtgaatttgaagac
gtcaagcttttaaacgatctcttggtagaaaagaacaaggaaactggatgggatacccca
attcatgttgatgcagctagtggtggattcattgcaccatttttgtacccagagcttgag
tgggactttaggcttccacttgtgaagagcatcaatgttagtggccacaaatatggtctt
gtttatgctggaattggttgggttatctggaggaacaaggaagacttgcctgaagaactt
attttccacattaactaccttggagctgatcaacccactttcactctcaatttctccaaa
ggttctagccaagtcattgctcagtattaccagctaattcgtttgggttatgagggatac
agaaatataatggagaactgtcatgaaaacgctatggtcctaaaagaagggttggagaaa
acaggtcgcttcaacattgtgtcaaaggacgaaggggttccactcgtggccttctctctc
aaggacaacaagcgccatgatgaattcgagatatccgaaatgctgcgccgatttggatgg
atcgtgccggcctacaccatgccggcggatgctcaacacatcacggtgctgcgtgtggtg
atcagggaagacttctcccgcaccttggcggagcgtcttgtgattgacatccaaaaggtg
cttcatgaactggatacactcccagcaaaggtaaatgccaaactggctatggctgaggaa
gaaaatagcaaaaatggcacagtgaagaagactgccattgaaacccagagggaaatcact
tcttactggaagaaatttgtgagcgagaggaagactaacaagaataaaatctgttag

DBGET integrated database retrieval system