KEGG   Gossypium raimondii: 105785987Help
Entry
105785987         CDS       T04129                                 

Definition
(RefSeq) hexaprenyldihydroxybenzoate methyltransferase, mitochondrial
  KO
K00591  polyprenyldihydroxybenzoate methyltransferase / 3-demethylubiquinol 3-O-methyltransferase [EC:2.1.1.114 2.1.1.64]
Organism
gra  Gossypium raimondii
Pathway
gra00130  Ubiquinone and other terpenoid-quinone biosynthesis
gra01100  Metabolic pathways
gra01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gra00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    105785987
Enzymes [BR:gra01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.64  3-demethylubiquinol 3-O-methyltransferase
     105785987
    2.1.1.114  polyprenyldihydroxybenzoate methyltransferase
     105785987
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_11 Methyltransf_25 Methyltransf_31 Methyltransf_12 PrmA CMAS NodS Ubie_methyltran MTS GidB Methyltransf_32 Methyltransf_9 AdoMet_MTase
Motif
Other DBs
NCBI-GeneID: 105785987
NCBI-ProteinID: XP_012467654
UniProt: A0A0D2QG82
LinkDB All DBs
Position
2
AA seq 302 aa AA seqDB search
MASSMFLAQRRWFLSLPRNLSNARFFSALPSEHPVSVSGPQNNVGPESNKFEKASSAPSS
LKEPELAKFSAIADTWWDSEGPFKPLHKMNPTRLAFLRSTLCRHFRKDPLSARPFEGLRF
IDVGCGGGILSEPLARMGATVTGIDAIEKNIKIARLHANLDPTTSTIEYCCTTAEKLVEE
QRKFDAVIALEVIEHVADAAEFCKSLSALTAHEGATVVSTINRSMRSYATAIVAAEYLLQ
WLPKGTHQWSSFLTPEELTMILKRAGVDVKEMAGFVYNPLTGRWSLSDDISVNFIAYGTK
EK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttcaatgttcctagcccaacgtcggtggttcctttcccttccaagaaacctt
tccaatgctcggttcttctctgctttaccttctgaacaccctgtttctgtttctggacct
caaaacaatgttggccctgaatctaacaagttcgaaaaggcttcttcagctccctcttcg
ttgaaggaacctgaactcgccaagttctctgcaattgccgatacttggtgggattctgaa
ggaccatttaaaccattgcataaaatgaatcctaccaggctcgcttttttacgctctact
ctttgtcgacatttccgaaaggatcctctctctgctaggccctttgaaggactaaggttt
atcgatgtcggttgcggtggtggtattctgtcagagccgctggctcgaatgggagcaact
gtcactggaattgatgcaatagagaaaaacatcaagattgcccgtcttcatgctaatttg
gatccaacaacttcaactattgaatactgttgtacaacagcagaaaagctggttgaagag
cagagaaagtttgacgcagtgattgctttagaggtgattgagcacgtagcagatgctgct
gaattctgcaagtctctctcagcattaactgctcatgaaggagcaactgttgtttcaaca
attaaccgctctatgagatcatatgcaactgccattgttgcagcagaatacctgctacag
tggctacctaaaggtacacatcaatggtcgagtttcctgaccccagaagaactcaccatg
attctaaaacgtgcaggggttgatgtgaaagagatggcgggatttgtgtacaacccttta
acagggagatggtcactatcggatgatattagtgtaaattttattgcttatggtactaag
gaaaagtaa

DBGET integrated database retrieval system