KEGG   Gossypium raimondii: 105788995Help
Entry
105788995         CDS       T04129                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
gra  Gossypium raimondii
Pathway
gra03030  DNA replication
gra03410  Base excision repair
gra03420  Nucleotide excision repair
gra03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:gra00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    105788995
   03410 Base excision repair
    105788995
   03420 Nucleotide excision repair
    105788995
   03430 Mismatch repair
    105788995
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:gra03032]
    105788995
   03400 DNA repair and recombination proteins [BR:gra03400]
    105788995
Enzymes [BR:gra01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     105788995
    6.5.1.6  DNA ligase (ATP or NAD+)
     105788995
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     105788995
DNA replication proteins [BR:gra03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    105788995
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     105788995
DNA repair and recombination proteins [BR:gra03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     105788995
   NER (nucleotide excision repair)
    Other NER factors
     105788995
   MMR (mismatch excision repair)
    Other MMR factors
     105788995
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2
Motif
Other DBs
NCBI-GeneID: 105788995
NCBI-ProteinID: XP_012471616
UniProt: A0A0D2RMQ3
LinkDB All DBs
Position
3
AA seq 799 aa AA seqDB search
MLTFRQSHLFRCTFCITRPLTPLLPPSSSHFLPSNSPFFRPKPLSLSSLNPHSNMSTRPS
AFDALMSNARRLAGKKSSSSSSPTKKRKSLDSSPTENPNPLKTVGSAEVKHDPEVSSDGI
GKPINDSPKPNLDEAKKPPDSKKVKVGSASERNVEMKGKIRLLKKKPADFDPNMVACWEK
GERVPFLFLSLAFDLISNETGRIVITDIVCNMLRTVIATTPDDLVATVYLAANKVAPAHE
GLELGIGDASIIKALAEACGRTESQVKSQYKDKGDLGLVAQASRSSQSMMRKPDPLTVIK
VFDTFRLIAKESGKDSQEKKKNRIKSLLVAATDCEPQYLIRLLQTKLRIGFSEQTLLAAL
GQAAVYNEQHSKPPPNVQSPLEEAAKIVKQVFSILPVYDKIVPALLTGGVWDLPKSCGFT
PGVPVGPMLAKPTKGVAEIINKFQDIDFICEYKYDGERAQIHYMENGSVEIYSRNAECNT
GKFPDVVAAISRFKKSSVKSFVLDCELVAYDRVQKKILPFQILITRARKNVVVSEIKVDV
CIFAFDILYLNGQPLLHEQLKVRKERLYDSFEEEPGFFQFATALTSNDLEEIQTFLNSAV
SSSCEGLIIKTLDRDATYEPSKRSLNWLKLKKDYMESIGDTLDLVPIAAFHGRGKRTGFY
GAFLLACYDENNEEFQSICKIGTGFSEAELEERSASLRSKVIPEPKSYYRCSEMMKPDVW
FETTEVWEVKAADLTISPVHRAAIGIVDPDKGISLRFPRLVRVREDKTPEQASSSEQVAE
MYNAQKHNQTNNEDDGEDD
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atgctaacgtttcgccaatcccatcttttccgctgtactttttgtattactcgtcctctc
acccctctccttcctccctcttcctcccatttccttccttccaactcgcctttctttcgc
cccaaacccctctctctttcttccttaaaccctcactccaacatgtccactcgcccctcc
gccttcgatgctttaatgtctaatgctcgccgtttagccggtaagaagagctcttcctct
tcttcgcccaccaagaaacgcaaatccctcgattcgtcgcccaccgaaaaccctaacccc
ctcaaaaccgtcggctccgctgaagtcaagcacgacccagaggtttctagtgatggaatc
ggaaagcccattaacgattccccaaaacccaatttagatgaggcgaagaaacccccggat
tcgaagaaggtgaaggtggggagcgcctccgagagaaacgtggagatgaaagggaaaatt
cggttgttgaagaagaagccggcggattttgatcccaatatggtggcgtgttgggagaaa
ggagagagggtgccgtttttgtttctgagcctggcgtttgatttgatatccaatgagacg
ggtcggattgtgataacggatatagtttgcaatatgttgaggactgttattgctaccacg
ccggatgatttggtggcgacggtttacttggcagcaaataaggttgctccggcgcatgag
gggttagagctgggaatcggtgatgcatccattatcaaggccctagctgaggcctgtggg
aggactgaatcacaggttaagagtcagtacaaggataaaggagacctgggccttgttgct
caggctagccgttcatctcaatcaatgatgcgcaagcctgatccattgactgttatcaaa
gtgtttgacacgtttcggctaattgctaaggaatctggaaaggatagtcaggagaagaaa
aagaatcgtatcaaatcacttcttgttgctgcaactgactgtgaacctcagtatttgatt
cgtctgcttcagacaaagctgcggattggattttcagagcagactctgttagctgcatta
ggacaggctgctgtatataatgaacaacattctaaaccacctccaaatgttcagtctcct
ttagaggaggctgctaagattgtcaaacaagttttttctatccttccagtctatgataaa
atagtcccagcactcttgactggtggtgtatgggatctgcctaagagttgtggctttacg
ccgggtgttcctgttggacctatgctagcaaaaccaaccaaaggtgttgctgaaatcata
aataaattccaggacattgacttcatatgtgaatataaatatgatggagagcgtgcgcag
atacactatatggagaatggttcagttgagatatacagtcgaaatgctgagtgtaacact
ggaaagtttcctgatgttgttgctgcaatttctagatttaagaagtcctctgtaaaatca
tttgttttggattgtgagcttgttgcttatgatcgtgttcaaaagaaaatattacccttt
cagatccttattacaagagcacggaaaaatgtggtagtgagtgaaatcaaagttgatgtg
tgcatattcgcttttgacatcttataccttaacgggcaaccacttcttcatgagcaactt
aaagttcgtaaggagaggctttatgattcatttgaggaagaacctgggttttttcaattt
gcaacagccttaacatcaaatgatcttgaggagattcaaacattccttaattctgctgtt
tcttcaagttgtgagggtttaattatcaaaacattggatagagatgctacatatgagcca
tcgaagcggtcactcaactggctaaaattgaagaaagactacatggaaagtattggcgac
acattagatctagtacctattgctgctttccatggccgtgggaaacgaactggcttctat
ggtgcttttctcttggcatgttatgatgaaaataatgaagaattccagagtatctgtaaa
ataggtactggattttctgaagcagagcttgaggaacgttctgccagtctccgctctaaa
gtgattcctgaaccaaagtcgtactatcgttgttctgagatgatgaagccggatgtatgg
tttgagactacagaggtttgggaggtaaaagctgcagacttgaccattagccctgttcat
cgtgctgctattgggattgtggatcctgataagggcatatctctccgatttccacgttta
gttcgtgttcgagaagataagacaccagagcaagcttcatcatctgagcaggttgctgag
atgtataatgctcaaaaacacaatcaaaccaataacgaagacgatggcgaggatgattga

DBGET integrated database retrieval system