KEGG   Gossypium raimondii: 105794343Help
Entry
105794343         CDS       T04129                                 

Definition
(RefSeq) glutamate decarboxylase 4-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
gra  Gossypium raimondii
Pathway
gra00250  Alanine, aspartate and glutamate metabolism
gra00410  beta-Alanine metabolism
gra00430  Taurine and hypotaurine metabolism
gra00650  Butanoate metabolism
gra01100  Metabolic pathways
gra01110  Biosynthesis of secondary metabolites
Module
gra_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:gra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    105794343
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    105794343
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    105794343
   00430 Taurine and hypotaurine metabolism
    105794343
Enzymes [BR:gra01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     105794343
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 105794343
NCBI-ProteinID: XP_012478938
UniProt: A0A0D2PTM5
LinkDB All DBs
Position
5
AA seq 545 aa AA seqDB search
MSPPPSKQTAFALRLPSFFISLPLSLFSSNFISFIFPVPSFGNTSTMVLSKTASETDVSI
HSTFASRYVRNSLPRFKMPENSIPKEAAFQIINDELMLDGNPRLNLASFVTTWMEPECNK
LIMDAINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGESEAAVGVGTVGSSEAIMLAG
LAFKRKWQNKRKAEGKPYDKPNIVTGANVQVCWEKFARYFEVELKEVKLREGYYVMDPAK
AVELVDENTICVAAILGSTLNGEFEDVKLLNDLLVEKNKETGWDTPIHVDAASGGFIAPF
LYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRSKDDLPEELIFHINYLGADQPTF
TLNFSKGSSQVIAQYYQLIRLGHEGYKNVMENCHENAMVLKEGLEKTGRFNIVSKDDGVP
LVAFSLKDNKRHDEFEISEMLRRYGWIVPAYTMPADAQHITVLRVVIREDFSRTLAERLV
LDIQKVVHELDALPAKLNARLATEKQEQVKNGTVKKTAIETQREITAYWKKYVTERKSNN
KTQIC
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgtctcctccaccaagcaaacaaacagcttttgctttaagattaccttccttcttcatc
tctctccctctctctctgttctcttcaaacttcatttcattcatttttccagttccttca
tttggtaatacatcaaccatggtgttatctaagacagcttctgagaccgatgtctcaatt
cactccacttttgcctctcgctatgtccgcaactcacttcccaggttcaagatgccggag
aactcaataccaaaagaggctgcatttcagatcatcaatgacgagctgatgcttgatgga
aacccaaggttaaaccttgcctcttttgttactacctggatggaacccgaatgtaataag
cttataatggatgccattaacaagaactatgttgacatggatgagtatcctgtcaccacc
gagctccagaatcgttgtgtgaacatgatagcacacttgttcaacgcaccgcttggggag
tcggaggctgctgttggagtgggaacagttgggtcatcggaagcaatcatgttggctggt
cttgctttcaagagaaagtggcagaacaaacgtaaggctgaaggcaaaccttatgataag
cccaacatcgtgacaggagccaatgttcaggtgtgttgggagaaatttgctcgctacttt
gaagtggagttgaaggaagtgaagctgagggaaggttactatgtgatggaccctgccaaa
gctgttgaattggttgatgaaaacaccatctgtgttgcagctatcttgggttccaccctc
aatggagaattcgaagatgtcaagcttctaaatgatctcttggtggagaaaaataaggaa
actggatgggataccccaattcatgttgatgcagctagtggtggatttattgcaccattc
ttgtacccagagcttgaatgggacttcaggcttcctcttgtgaagagtattaatgttagt
ggccataaatatggtcttgtttatgctggaatcggttgggttatctggagaagcaaggat
gacttgcctgaagaacttattttccacattaactaccttggagctgatcaacccactttc
actctcaatttctccaaaggttccagccaagttattgctcagtactatcaattaatccga
ttgggccatgaggggtacaaaaacgtgatggagaactgccatgaaaacgctatggtcctt
aaagaaggattggagaaaacagggcgtttcaacatcgtgtcaaaggacgatggggtgcct
ttagtggcattttctctcaaggacaacaagcggcacgacgagttcgagatatcggagatg
ttgcgccgatacggttggattgtgcctgcatacaccatgccagcagatgctcagcacatc
accgtgcttcgtgttgtcatcagggaagacttctctcgaaccttggctgagcgccttgtg
cttgacatccaaaaagtggtccatgagctcgatgccctccctgcaaagctcaatgccaga
ctggccactgagaaacaggaacaagttaaaaatggcactgttaagaagactgctattgag
acccagagggaaatcactgcttactggaagaaatatgtcactgagaggaaatctaacaac
aaaacccagatttgttag

DBGET integrated database retrieval system