KEGG   Gossypium raimondii: 105794627Help
Entry
105794627         CDS       T04129                                 

Definition
(RefSeq) glutamate--glyoxylate aminotransferase 2
  KO
K14272  glutamate--glyoxylate aminotransferase [EC:2.6.1.4 2.6.1.2 2.6.1.44]
Organism
gra  Gossypium raimondii
Pathway
gra00220  Arginine biosynthesis
gra00250  Alanine, aspartate and glutamate metabolism
gra00260  Glycine, serine and threonine metabolism
gra00630  Glyoxylate and dicarboxylate metabolism
gra00710  Carbon fixation in photosynthetic organisms
gra01100  Metabolic pathways
gra01110  Biosynthesis of secondary metabolites
gra01200  Carbon metabolism
gra01210  2-Oxocarboxylic acid metabolism
gra01230  Biosynthesis of amino acids
Module
gra_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
gra_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:gra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    105794627
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    105794627
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    105794627
   00260 Glycine, serine and threonine metabolism
    105794627
   00220 Arginine biosynthesis
    105794627
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gra01007]
    105794627
Enzymes [BR:gra01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     105794627
    2.6.1.4  glycine transaminase
     105794627
    2.6.1.44  alanine---glyoxylate transaminase
     105794627
Amino acid related enzymes [BR:gra01007]
 Aminotransferase (transaminase)
  Class I
   105794627
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Synaptonemal_3
Motif
Other DBs
NCBI-GeneID: 105794627
NCBI-ProteinID: XP_012479346
LinkDB All DBs
Position
5
AA seq 509 aa AA seqDB search
MGLKALDYETMNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPQALGQKPLTFPR
QVVALCQAPFLLDDPNVGLIFPADAIARAKHYLSLTSGGLGAYSDSRGIPGVRKEVAEFI
ERRDGYPSDPELIFLTDGASKGVMQILNCIIRGQGDGVLVPVPQYPLYSATISLFGGSLV
PYYLEETANWGLDVNNLRESVAQARFKGITVRAMVIINPGNPTGQCLSEANLREILNFCY
QENLVLLGDEVYQQNIYQDERPFISSRKVLMDMGPPISKDVQLVSFHTVSKGYWGECGQR
GGYFEMTNIPPKTVDEIYKIASISLSPNVPAQIFMGLMVNPLKPGDVSYDQFVRESKGIL
ESLRRRARIMTDGFNSCKNVVCNFTEGKSLLSTGHSKAFVFCDFFSALLLGYHTGAMYSF
PQLRLPPKAIEAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE
DMPEIMSSFKKFNDEFMAQYEDNWNRSRM
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgggtcttaaggcattagactatgagacaatgaatgaaaacgtgaagaaagttcaatat
gcagttagaggtgagttgtatcttcgagcttctgagcttcagaaggaagggaagaagatt
attttcacaaatgttggcaatcctcaagctcttggacagaagccactgactttccctcgt
caggtggttgctttgtgccaagccccatttctgctagatgatcctaatgtaggacttata
tttcctgctgatgccattgcaagagcaaaacattatctttcattgacttctggtggtcta
ggtgcatatagtgattccagaggtattccaggcgttaggaaggaggttgctgaattcatt
gagaggcgtgatgggtatcctagtgacccagagctcatatttctcactgacggtgccagc
aaaggtgtgatgcagatcttgaattgtattatccgtggtcaaggggatggggttttggtt
cctgttccacagtatccactttactcagctacaatatctctctttggcggttcacttgtt
ccttactacctagaagagactgcaaactgggggctggacgtaaacaatcttcgtgaatca
gttgcacaggctcgcttcaaaggaataactgtgagagcaatggtaattattaaccctggg
aaccctactggtcagtgtctcagtgaagctaatttaagagaaatattgaatttttgttac
caagaaaacttggtattacttggagatgaggtttaccaacagaatatataccaggacgag
cgcccctttatcagttctagaaaggtgttgatggatatggggccaccaattagcaaggat
gtccagctcgtttctttccacactgtgtctaaaggatattggggtgaatgtgggcagcga
gggggatactttgagatgaccaacattcctccaaagacagttgacgagatatacaagatt
gcatcaatatccctcagtcctaatgttcccgctcagatatttatgggattgatggtcaac
ccactcaaacctggagatgtttcatatgatcaatttgttagggaaagcaaaggaatcctt
gaatcattgagaagaagagcaaggataatgactgatggatttaacagctgcaaaaatgtg
gtttgtaatttcactgaaggtaaatcgttgttatcaacaggtcactcaaaagcttttgtt
ttttgtgatttcttctcagcacttcttcttggctatcatacaggtgccatgtattctttt
cctcaattacgcttaccaccaaaagctatagaagctgccaaacaggcaggaaaagtccca
gatgttttctactgtctcaagttgttggaagcaacaggcatctcaactgtcccgggctcc
ggattcggacaaaaagaaggggttttccacttgaggactacaattctacctgctgaggaa
gacatgcctgaaatcatgtcgagtttcaagaaattcaacgacgagttcatggctcaatat
gaagataactggaatcgttcaaggatgtga

DBGET integrated database retrieval system