KEGG   Gossypium raimondii: 105798019Help
Entry
105798019         CDS       T04129                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 1
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
gra  Gossypium raimondii
Pathway
gra00620  Pyruvate metabolism
gra00710  Carbon fixation in photosynthetic organisms
gra01100  Metabolic pathways
gra01200  Carbon metabolism
Module
gra_M00168  CAM (Crassulacean acid metabolism), dark
gra_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
gra_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
gra_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:gra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    105798019
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    105798019
Enzymes [BR:gra01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     105798019
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 105798019
NCBI-ProteinID: XP_012483343
UniProt: A0A0D2NJI9
LinkDB All DBs
Position
6
AA seq 965 aa AA seqDB search
MAGRKVEKMASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC
YELSAEYEGKHDPKILEELGKVLTSLDPGDSIVVTKSFSHMLNLGNLAEEVQIAYRRRIK
LKKGDFADESSATTESDIEETFKRLVGQLNKSPEEVFDALKNQTVDLVLTAHPTQSVRRS
LLQKHGRIRNCLTQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRNPPTPQDEMRAGM
SYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
DVCLLARMMAANLYFSQIEDLMFELSMWRCSDELRIRADELHRSSKKDAKHYIEFWKQIP
PNEPYRVILGDVRDKLYNTRERARSLLANGFSDIPEEAAFTNVEQFLEPLELCYRSLCAC
GDRPIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLDAITKHLDIGSYREWPEERR
QEWLLSELGGKRPLFGPDLSKTEEVADVLDTFHVISELPSDSFGAYIISMATAPSDVLAV
ELLQRECRVKQPLRVVPLFEKLADLEAAPAAVARLFSIDWYRDRINGKQEVMIGYSDSGK
DAGRLSAAWQLYKAQVELVKVAKQYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIHG
SLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPVSPNPEWRALMDEMAVVATK
EYRSVVFQEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRF
HLPVWLGFGAAFKHVIQKDIKNLHMLQEMYNQWPFFRVTMDLIEMVFAKGDPGIAALYDK
LLVSKELWPFGENLRANYEDTRRLVLQVAGHRDLLEGDPYLKQRLQLRDAYITTLNVCQA
YTLKRIRDPDYHVKVRPHLSREYMESSKAAAELVKLNPTSEYAPGLEDTLILTMKGIAAG
MQNTG
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atggcaggtagaaaagtagagaagatggcttcaatagatgcacaactaaggctattagca
cctgggaaagtctctgaggatgataagttggttgaatatgatgctctgctactggatcgt
tttcttgatattcttcaggatttgcatggagaggatatcagagaaacggttcaagaatgc
tacgagctttcggcggagtacgaaggaaagcatgatcctaaaatattggaggagcttggc
aaggtacttacaagcttggatcctggggactcaattgttgttaccaaatcattttcccac
atgcttaacttgggaaacttggccgaggaggttcaaattgcatatagacgaaggattaag
ttgaagaaaggagattttgcagatgagagttcagcaacaactgaatcagatattgaagag
acgttcaagcgacttgtggggcagttgaacaagtcccctgaagaagtttttgatgctttg
aagaatcagactgtagatttagtcttaactgcacatcctacacagtctgttcgaagatct
ttacttcaaaaacatggaaggatacgtaattgtttgacacaattgtatgctaaagacatt
acacctgatgataagcaggaacttgatgaggcactacaaagggagattcaagctgctttt
cgcacagatgagatccgaaggaatcctcccaccccacaagatgagatgagagcaggaatg
agctacttccacgagacaatctggaaaggtgtaccaaaattcttgcgtcgtgttgacaca
gcgttgaagaacatagggataaatgaacgtgttccatacaacgcccctcttattcaattc
tcttcatggatgggaggggatcgtgatggaaaccccagggtaactcctgaagttacaaga
gatgtctgcttattagctagaatgatggctgctaacttgtacttctcccaaatagaggat
cttatgtttgagttatcaatgtggcgttgcagcgatgaacttcgtattcgtgcagatgaa
ctccataggtcctccaaaaaggatgcaaagcattacatagaattttggaaacagattcct
ccaaatgagccatatcgcgttattcttggtgatgtgagggacaagctgtataatacacgt
gaacgtgctcgtagcctgttggccaatggattttctgacattcctgaagaagcagcattt
accaatgtggagcagtttctggagcctcttgaactctgctatagatcactctgtgcttgt
ggtgatcggccaatagctgatggaagccttcttgatttcttacggcaagtttctaccttt
gggctttcacttgtgagacttgatatccggcaggaatctgacagacacactgatgtcctt
gatgctatcacaaagcacctggatattggatcttatcgagaatggcctgaggaacgccga
caggaatggctcttatctgaacttggaggcaagcgccctttattcggccctgatctttcc
aaaacagaagaagtcgccgatgtattggacacatttcatgtcatttctgaattgccttca
gacagctttggtgcctatataatctcaatggctacagccccatctgatgtgcttgctgtt
gagcttttacaacgtgaatgccgtgtaaagcaaccattacgggtagttccattgtttgaa
aaactcgctgatcttgaagctgctcctgctgctgtggctcgtctcttctctatagattgg
tacagagaccggatcaatgggaaacaggaagtgatgataggttattcagattcaggaaag
gatgctggccgtctttctgcagcatggcagctatacaaggctcaggtggaacttgtaaag
gtggcaaagcagtatggtgttaagcttacaatgttccatggccgaggagggacagttgga
agaggagggggacccacgcatcttgctatattgtctcaaccacccgatacaattcatgga
tcacttcgtgtaacagttcaaggtgaagttattgaacaatcatttggagaggagcacttg
tgcttcaggacgcttcagcgttttactgctgctacacttgagcatggaatgcatccccct
gtctcaccaaatccagaatggcgtgcactcatggatgaaatggcagtagttgcaacgaag
gaataccgttctgtagtcttccaggaacctcgctttgttgaatacttccgcctagcaaca
cccgaattggagtatggtcggatgaatattggaagccgtccatcaaaaaggaaaccaagt
ggaggcattgaatcactccgtgcaatcccatggatctttgcatggactcaaacaagattt
catttacctgtgtggcttggctttggggctgcatttaagcacgtcattcagaaggatata
aagaatctccacatgctccaggagatgtacaaccaatggcctttctttagggtcacaatg
gacttaattgaaatggtatttgccaagggagaccctggaatcgctgccttatatgacaag
ctactagtgtcaaaggaactctggccctttggagagaacttgagagctaactatgaagac
actagacgacttgttctccaggttgctggacacagagatcttcttgaaggtgacccttac
ctgaagcagaggctccaacttcgtgatgcttacatcacaacccttaatgtctgccaagca
tacactttgaaaaggatccgtgaccctgattatcatgtcaaggtcaggcctcacttatcc
agggaatacatggaatcaagcaaggcggcagctgagcttgtgaaacttaaccctacaagc
gagtatgctcctggtctggaagacacccttattttgaccatgaagggtattgctgctgga
atgcaaaacactggctaa

DBGET integrated database retrieval system