KEGG   Gossypium raimondii: 105799579Help
Entry
105799579         CDS       T04129                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit C-like
Organism
gra  Gossypium raimondii
Pathway
gra03013  RNA transport
Brite
KEGG Orthology (KO) [BR:gra00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    105799579
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N PCI TRI5 DUF2982 LMBR1
Motif
Other DBs
NCBI-GeneID: 105799579
NCBI-ProteinID: XP_012485668
UniProt: A0A0D2QA22
LinkDB All DBs
Position
6
AA seq 918 aa AA seqDB search
MASKFWTQGGSDTEEEETDIEDEIENGGAGETTAAAAGSRYLQTNASDSDDSDGQKRVVR
SAKDKRFEEMASTVDQMKNAMKINDWVSLQESFDKINKQLEKVMRVTESDRVPNLYIKCL
VMLEDFLAEALANKEAKKKMSSSNHKALNAMKQKLKKNNKQYEELINKYRENPESEEEKF
EDEDEDEDEDESGSELEDPSQIAAESSDEDDEGEDVDDDDANGAWEKKLSKKEKLMDREF
KKDPSEITWDTVNKKFKEVVAARGRKGTGKFEQVEQLTFLTKVAKTPAQKLEIFFSVISA
QFDVNPGLSGHMPINVWKKCVQNMLVILDILVQYPNIVVDDMVEPDENETQKGADYDGTI
RVWGNLVAFLERIDNEFFKSLQCIDPHTREYVERLRDEPLFLVLAQNVQEYLERIGDLKS
AAKVALRRVELVYYKPQEVYDAMRQLAVLSEDGEKDGDETKVEETRGTSAFVVTPELVSR
KLTFPENSRALMDILVTLIYKSGDERTKARAMLCDIYHHALFDEFSIARDLLLMSHLQDT
IQHMDVSTQILFNRAMAQVGLCAFRVGLIAEGHGCLSELYSGGRVKELLAQGVSQSRYHE
KTPEQERLERRRQMPYHMHINLELLEAVHLICAMLLEVPNMAANSLDAKRKVISKTFRRL
LEVSERQPFTGPPENVRDHVMAATRALCKGDFQKAFDVINSLDVWKLLRNRESVLEMLKA
KIKEEALRTYLFTYCSSYDTLGLDQLTKMFDLSDAQIHSIVSKMLVNEELHASWDQPTRC
IIFHDVEYSRLQALAFQLTEKLSILAESNERAVEARFGGGGLDLPLRRRDNQEYAAGTAG
GGGGRWPDLSYNQGRQGSSGRAAYTGGGRPLALGQASRDRSSQSRGTGGYSGRAGSGMRG
YQMDASARMVSLNRGVRG
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atggcatctaaattctggactcagggtggcagtgacactgaagaagaggagaccgatatt
gaagatgaaattgagaatgggggagctggagaaaccacagccgccgctgccggaagcaga
tatctacaaacaaatgctagtgatagtgatgattccgatgggcaaaagagggtggttaga
tccgccaaagataagaggtttgaggagatggcaagtacggttgatcagatgaagaatgca
atgaaaatcaatgactgggttagcttgcaagagagttttgataagattaataaacagttg
gagaaggttatgcgtgttaccgagtccgacagagttccaaatctttatattaagtgtctt
gttatgttggaagatttcttagctgaagctttggctaataaggaagccaaaaagaaaatg
agtagcagtaatcacaaggctttgaacgcaatgaaacagaagctcaagaagaataataag
cagtatgaggaattgattaacaagtatagggagaatcctgagagtgaagaggagaagttt
gaagatgaggacgaagatgaggatgaagatgaatctggctctgagttggaggacccctca
caaattgctgctgagtctagtgatgaggatgatgagggggaagatgtggatgatgatgat
gctaatggggcctgggagaagaaactaagcaagaaagagaaactgatggatcgggagttt
aagaaagatcctagtgagatcacctgggatactgttaacaagaagtttaaagaggttgtg
gctgctaggggaaggaagggaactggaaaatttgaacaggtcgagcagcttaccttcttg
acaaaggttgccaagactcctgctcagaagcttgagatctttttcagtgttatctctgca
cagtttgatgttaatccaggtcttagtggacacatgcctataaatgtgtggaagaaatgt
gtacagaatatgcttgtcatattggacattcttgttcagtacccgaacattgtggtcgat
gatatggttgagcctgatgagaatgaaacccaaaagggagcagactatgatggaactatc
cgtgtttggggaaatttggtggccttccttgagagaatagataatgagttctttaagagc
ttgcagtgcattgatccacacactcgtgagtatgttgagagactgagagatgaacctttg
tttttggtccttgctcaaaatgtccaggagtatttagagcgtattggtgatttgaagtct
gctgctaaggttgctctaaggcgggttgaacttgtctattacaagcctcaagaggtttat
gatgctatgaggcaactggctgtgctatcagaagatggagaaaaagatggcgatgagact
aaagtggaggaaacacggggtacatctgcgtttgttgttactcctgagcttgtgtcccgg
aagctcacattccccgagaatagtagagcattgatggatatcctagtgaccctcatatac
aaaagtggagatgagaggaccaaagctcgtgcaatgctttgtgatatttaccatcatgcc
ctttttgatgagttttcaattgctcgtgatttgctactgatgagtcatttacaggatact
attcagcatatggatgtttcaacacagatactttttaaccgggcaatggctcaggttggc
ctctgtgccttccgtgttggactaattgctgaaggacatggctgcctttctgaactgtat
tctggtgggagggtgaaggaattgcttgcacaaggtgtttcacaaagccgatatcatgag
aaaaccccagaacaggaaaggttggaaaggaggcgtcagatgccctaccatatgcacata
aatcttgagcttctggaggctgtgcatttgatatgtgctatgcttcttgaggttcctaac
atggcagccaactcccttgatgccaaacgcaaggtgataagtaagacattcaggcggttg
cttgaggtgagtgagaggcagccatttacaggtcccccagaaaatgtgcgagaccatgta
atggctgcaacccgggccctctgcaagggagatttccagaaggcctttgacgtcattaat
tctcttgatgtttggaagctccttaggaatagagagagcgtgcttgaaatgctgaaagct
aagatcaaggaagaggctctgaggacttacctttttacctactgttcttcctatgataca
ctaggcctggaccagctcaccaaaatgtttgacctctcagatgcccagattcatagcatt
gttagcaagatgttggtaaatgaagaactccatgcaagctgggaccagccaactcgatgc
atcatcttccatgatgttgagtactcaaggttgcaggccttggcattccagttgacagaa
aagctttcaatacttgctgagagtaatgagagggcagtcgaggctagatttggtggtggt
ggattggatctgccactaaggcggcgagataaccaggaatatgctgctgggacagctggc
ggcggcggcggtaggtggccagacttgtcctacaatcagggtaggcaaggtagttctgga
cgtgccgcgtatactggtggtggcagaccattggcattagggcaggcttcaagggatcgg
tcaagtcaatcacgaggaacaggcggatactctgggagagccggttcaggaatgagaggt
taccagatggatgcttcagctcgcatggttagtctcaatcggggtgttcgcggttag

DBGET integrated database retrieval system