KEGG   Gossypium raimondii: 105802490Help
Entry
105802490         CDS       T04129                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
gra  Gossypium raimondii
Pathway
gra00562  Inositol phosphate metabolism
gra01100  Metabolic pathways
gra04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:gra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    105802490
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    105802490
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gra01009]
    105802490
Enzymes [BR:gra01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     105802490
    3.1.3.48  protein-tyrosine-phosphatase
     105802490
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     105802490
Protein phosphatases and associated proteins [BR:gra01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    105802490
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase3 Y_phosphatase PTPlike_phytase DSPn
Motif
Other DBs
NCBI-GeneID: 105802490
NCBI-ProteinID: XP_012489617
LinkDB All DBs
Position
7
AA seq 450 aa AA seqDB search
MKDHHHHPHDLQPQQQLQPHCSYFDILKLSRYQQMGLEFTKAGPIKGANTTLLLQHKMLS
YLSASSFIRNLVSKKRRRMLVGGYDLDMSYITDRLLAMSFPAERMRAMYRNPLWQVKSVL
EMIHKGHYRVYNLCIEEDYDPSHFHGRVEKFPFDDNHVPHFEMMKSFCESVHSWLSDDPK
NIAVVHCMAGKGRTGLMVCAYLVYTGMSAEEALQLYAQKRTTNNEGVSIPSQRRYVGYWE
KLLSFTRGIGNGPVDVHLPQPCSRELRRIRLYDTVNTNSVFFVVSELQEIPDQMNRPPVE
VAKRCCRQIKKGSEANCSPRYFLSYVEGDKEGATPESEEPRVVVQMDTESPILYQKNCLD
YRFNKPVEVKGDVRVIFYQKMIGGRLFYACFNTAFIKSSLLQFTIRDLDKVGSAGRSICG
PAFCVELLFGPANRSLSSAFSSNYDKHLDC
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatcatcatcatcatcctcatgatcttcagccgcagcagcagcttcaaccccat
tgcagctactttgacattctaaagttgtcaaggtatcagcagatggggttggaatttacg
aaggcgggcccaataaagggtgcaaacaccacccttctcctccagcataaaatgctttct
tatctttcagcaagttctttcattcgaaacctggtgtcgaagaaaagaaggcgaatgcta
gtcggtggatatgatctggacatgtcctatataactgatcgtttgttggcaatgtctttc
cctgccgaacgtatgcgagcaatgtatcggaatcctctatggcaggtcaagtctgtgctg
gaaatgatacataaggggcattacagggtctacaatttgtgcatagaagaagattatgat
ccatcacacttccatggtcgagtcgagaagttccctttcgatgacaatcacgttccccac
tttgaaatgatgaagtcattctgtgagagtgttcattcatggctatcagatgaccctaaa
aacattgcagttgttcattgcatggcaggaaaaggtcgaacaggcttaatggtgtgtgcc
taccttgtttacaccggaatgtcagctgaggaagcacttcagttatatgcccaaaagcgg
acaactaacaatgaaggagtctctataccaagccaacgccgttatgtggggtattgggaa
aaattactttcttttaccagaggcattggcaatggacctgtcgatgtgcacttgcctcaa
ccatgtagccgagaattgcggcggatacgactttacgacacagttaataccaactctgtc
ttcttcgttgtctcggagctccaagagattccggatcagatgaaccgcccgcctgttgaa
gttgccaagagatgctgtcgacaaatcaaaaaaggaagtgaagcgaattgcagtcctcga
tatttcttgtcatatgttgaaggggacaaagaaggggctacaccagaatcggaagaacct
cgtgttgtagtccaaatggacacggagagtcccatattatatcagaagaactgtcttgac
tatcgtttcaataaacctgtggaagttaagggagacgtgcgcgtcatattctatcaaaaa
atgatcggaggtcgccttttttatgcctgtttcaatacagccttcatcaagagcagcttg
ctacagtttacgatccgggatctggacaaagttgggagtgccggcagatcaatatgcggc
cctgcattctgtgtcgagttgcttttcggtccggccaatcggagcctctcgagtgctttt
tcatctaattatgataaacacttggattgttaa

DBGET integrated database retrieval system