KEGG   Gossypium raimondii: 105803935Help
Entry
105803935         CDS       T04129                                 

Definition
(RefSeq) histone-lysine N-methyltransferase CLF-like
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
gra  Gossypium raimondii
Pathway
gra00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:gra00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    105803935
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gra03036]
    105803935
Enzymes [BR:gra01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     105803935
Chromosome and associated proteins [BR:gra03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     105803935
   Polycomb group proteins
    PRC2-EZH2 complex
     105803935
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET preSET_CXC TCR
Motif
Other DBs
NCBI-GeneID: 105803935
NCBI-ProteinID: XP_012491834
UniProt: A0A0D2SHS4
LinkDB All DBs
Position
7
AA seq 922 aa AA seqDB search
MAAKSSPSASADRSGSPKDSSMTTDEKTPTVKEVLLIIDSLKTQLTADRSVYVKKRLEEN
RQKLGGITYHLYKLSNERRSSWISDTDSAPDLLTKRQKDALGMQNGIDASNGDKDRYSCQ
ESSTAVLMGSSIPVKNAVRPIKLAEVKKLPPYTTWIFLDRNQRMTEDQSVVGRRRIYYDQ
NGGEALICSDSEEEVIEEDEEKRDFVESEDFIVRMTIKQVGLSDPVLESLAQCLSRSPCE
VKARYETLMKEEKDAGASKNGDVEVENWNSFLEKDLEAALDSFDNLFCRRCLVFDCRLHG
CSQDLIFPQADKQTPWNHPDEENVPCGLHCYRTVLKLERNGTVSSPIDPEEKLNSSSDGV
GARTSSYKKSSGSSARRKVKSCHSENASSNAKNLSESSDSEIGPRHEDASPIPQLSPSKN
KIAGKSGILKRNSKRVAERVLICMRKRQKKMAASASGSAVSGGVSPIDIKLQSDVQKENE
DVTSSSQNVKPPNTGRSRRKEWSLGVQGEFSEVPSSEMINGLAQATSNGGLRKEEFLDEN
LCEQAPNDDKSWKAIEKGLFEKGVEIFGNNSCLIARNLLNGLKTCWEVFQYMTCSGNKLA
CHAADGVMSLLDGYSKFDLNGSVGNNEVRRRSRFLRRRGRVRRLKYTWKSAAYHSIRKRI
TERKDQPCRQYNPCSCQTACGKQCSCLLNGTCCEKYCGCPKSCKNRFRGCHCAKSQCRSR
QCPCFAADRECDPDVCRNCWVSCGDGTGTLGVPPQRGDNYECRNMKLLLKQQQRVLLGRS
DVSGWGAFLKNSVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLDAYR
KGDKLKFANHSPDPNCYAKVIMVAGDHRVGIFAKERINAGEELFYDYRYEPDRAPAWARK
PEASGSKKEEVAPSSGRAKKLA
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgaaatcttcgccctctgcttcggcggatagatcgggatctcctaaggactcc
tcgatgacaactgatgaaaaaactcccactgttaaggaggttttattgattattgattca
ttaaagacacagctgacagctgaccgatctgtttatgtaaagaaaagattggaagaaaac
agacaaaaattgggtggtataacgtaccatctctacaaattgtcaaatgaacgaagaagt
agttggattagtgatactgatagtgctccggatttattgacaaagaggcaaaaagatgca
ctaggcatgcaaaatggtattgatgcaagtaatggggataaggatcgttatagctgtcaa
gaatcttctacagcggttctcatgggatctagtattcctgtcaagaatgctgttcgtcct
attaagcttgcagaagtcaaaaagttgccaccttatactacgtggatatttctagacaga
aatcaaagaatgactgaggatcaatcagtggtgggtcgaaggagaatttactatgatcaa
aatggtggtgaagcacttatctgcagtgacagtgaagaggaagtaattgaggaagatgaa
gaaaaaagagattttgtggaatctgaagactttattgttcgaatgactatcaagcaagtt
ggtttgtctgatccagtactggaatcactagcacaatgtttgtctagaagtccttgtgaa
gtcaaggcaagatatgaaacccttatgaaggaggaaaaggatgctggggcctctaagaat
ggggatgttgaagtggaaaattggaattcttttcttgaaaaggatcttgaagcagctctt
gattctttcgacaatttattttgtaggcgatgccttgtgtttgattgcagattacatgga
tgttctcaggaccttatctttcctcaggctgacaaacaaactccatggaaccatccagat
gaagagaatgtgccatgtggcctgcattgctatcgtacggttctgaagttagaaagaaat
ggaacagttagctcaccaatagatcccgaagaaaagttaaactcttcatctgatggtgtt
ggggctcgaacatcatcctataagaaatcttctggttcatctgctaggaggaaggtaaaa
tcctgccatagtgaaaatgcttcatccaatgctaaaaatctttcagaaagtagtgactca
gagattggacctaggcatgaagacgcctcacctattccccagttatcaccttctaagaat
aaaattgctggaaaatctggaattctcaagaggaatagcaagcgagttgctgaacgtgtt
ttgatttgcatgcgcaagaggcagaaaaagatggcagcttctgcttctggttctgctgtg
agtggaggtgtttcacctatagacattaaactccaatctgatgtacaaaaagaaaatgaa
gatgttacgtcttcttcacagaacgtgaaacctccaaatacaggacgatctaggaggaaa
gagtggtcattaggagtccaaggagaattttctgaagttccttccagtgagatgattaat
ggtttggctcaggctactagcaatggtggcctgagaaaagaagagtttttggatgaaaac
ttatgcgaacaagcaccaaatgatgataaatcttggaaggctattgaaaaaggtcttttt
gagaaaggtgtggagatttttggcaataacagctgtttgattgccagaaatcttttaaat
ggattgaagacatgctgggaggttttccaatacatgacctgctctggcaataaacttgct
tgccatgcagctgatggtgttatgtctcttcttgatgggtattccaagtttgaccttaat
ggatccgtgggaaataatgaagtaagacggagatcaagattcttgcgcagaaggggtaga
gtccgtcgtttgaagtatacctggaaatcagctgcatatcattcaatcaggaaaaggatt
actgagaggaaagatcagccttgccggcagtataatccttgtagttgtcaaacagcttgc
ggaaagcaatgttcttgccttttaaatgggacctgctgtgaaaaatattgcggatgccct
aagagttgcaagaatcgatttaggggctgtcattgtgctaaaagtcaatgtcgaagtcgt
cagtgtccatgctttgctgcagacagggaatgtgacccagatgtttgtagaaactgttgg
gtcagttgtggagatggcactggtactcttggagttcctccacaaagaggtgacaattat
gaatgcagaaacatgaagcttcttctcaaacaacagcaaagggtcttgcttggaagatca
gatgtttctggatggggagctttcttgaagaatagtgttggcaagcatgaataccttggt
gagtacactggggaactgatttcacatagggaagcggataaacgtggaaagatatatgac
cgtgaaaattcttcatttctcttcaacctgaatgatcagtttgttcttgatgcttatcga
aagggtgacaagttgaagtttgcgaatcattctcctgatcctaattgctatgcaaaggtc
attatggttgctggggatcaccgggtgggaatatttgcgaaagaacgaattaatgctgga
gaggaacttttctatgactatcgttatgagcctgacagagctcctgcatgggcaagaaag
cccgaggcatctggttccaaaaaagaggaagttgctccttcaagtggacgtgccaagaag
cttgcttaa

DBGET integrated database retrieval system