KEGG   Gramella salexigens: LPB144_04085Help
Entry
LPB144_04085      CDS       T04586                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
grl  Gramella salexigens
Pathway
grl00620  Pyruvate metabolism
grl00680  Methane metabolism
grl01100  Metabolic pathways
grl01120  Microbial metabolism in diverse environments
grl01200  Carbon metabolism
Module
grl_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:grl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LPB144_04085
  09102 Energy metabolism
   00680 Methane metabolism
    LPB144_04085
Enzymes [BR:grl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     LPB144_04085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 LuxQ-periplasm SHE3
Motif
Other DBs
NCBI-ProteinID: APG59637
UniProt: A0A1L3J3D9
LinkDB All DBs
Position
complement(938112..940694)
Genome map
AA seq 860 aa AA seqDB search
MHREPRLERFNDNVLAKYQVYNSIFLTLPYDDIRKTGALLPLFLEICETGFSENKNPSEI
VERFFDKYGENPSEKEKIDLLFRFIQYIERQVVLFDAIEDASFPIVNNMDGRGTLRSVKE
EAEAKQKVGELKEYLKRFKVRPTLTAHPTQFYPGTVLGIITDLDKAIQKNDLIKIKSLLA
QLGKTPFFKKEKPTPYDEAVNLIWYFENVFYPSASKIHNYLQHNIFDGENLDNQVINLGF
WPGGDRDGNPFVTTDITLRVAKRLRRTILLNYYRDIRKLKRRLTFRGVHELMGEIEKGLY
DSAVSNAGDVKIELDDFKSKLQDIKNILVEQHRSLFVDEIDDMLNKLNLFGYHFATLDIR
QDSSIHQEVLEEVIKVFGDVEGSIPSNFNELSNDEQIDVLTKVNAKLDPEKMEEGMGKAT
LSSIYAMQEIQEKSGEEGANRYIISNCGSVQGVLQPFAFMKLCGWEKPTADVIPLFETVP
DLQNAHNVMEVLYKNPVYKEHLERRGNKQTIMLGFSDGTKDGGYLMANWSIYKAKETLTK
VSREYGIKVVFFDGRGGPPARGGGKTHQFYASLGPTIENEEIQLTVQGQTISSNFGTKDS
CTYNLEQLLSSGVSNEIFSDGKNVLTDEDRKTMTELAEISYETYTNFKKHPRFIPYLEKM
STLKYYAKTNIGSRPSKRNKSAELNLSDLRAIPFVGSWSQLKQNVPGFFGVGTAMEKLEK
AGEFDRVKSLYQNSEFFKTLLENSMMSLTKSFFPLTAYMKDDEEFGEFWQLIYEEFERTK
SMLLKVTGYDHLMQNQPAGRASIQTRERIVLPLLTIQQHALKMVQELSKNPEKEAERLEI
YEKMVTRSLYGNINASRNSA
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atgcatagagaaccaagattagaaagatttaatgataatgtacttgcaaaatatcaggtt
tataatagcatcttcttaaccctaccttatgatgatattagaaaaacgggggctctttta
cctttattccttgagatttgtgaaactggttttagtgaaaacaaaaacccttcagaaatc
gtagagagattttttgataaatatggagagaaccctagcgaaaaagagaaaattgatctt
ttatttcgtttcattcaatacatagaaagacaagtggttctatttgatgcgatagaagat
gcctcttttcctattgttaataatatggatggcagaggaaccttgcgaagtgtgaaggaa
gaagcagaagcaaagcagaaagtaggagaattaaaggaatatttgaaaaggtttaaggtt
agaccaaccttaactgcgcaccctacacagttttatcctggaaccgttttagggatcatt
acagatctggataaagccattcagaaaaatgatctgatcaagattaaatcattactggct
caattaggaaagacgccgttctttaaaaaggaaaaaccaacaccttacgatgaggcggtt
aaccttatatggtattttgaaaatgttttttatcctagtgccagcaagatccataattac
ttacaacataatatttttgacggtgagaatctggataatcaggttataaaccttggcttc
tggcctggaggggaccgtgatggaaacccttttgtaacaaccgatattacacttagggtg
gctaaaagattaagaagaacaattcttctaaactattatcgtgatattagaaagctaaag
cgaagattaacctttagaggtgttcacgaactaatgggtgagattgaaaaaggattatat
gattctgccgtttccaatgctggagatgtgaaaatagaattagacgattttaaatccaaa
ctacaggatattaagaatatccttgtggagcaacaccgctcattatttgtggatgagata
gacgatatgcttaataaattaaatctgtttggataccattttgccactctggacatacgt
caggattctagcattcatcaggaagtacttgaagaagtaattaaagtatttggagatgta
gaagggtctattccttctaatttcaatgagttaagcaatgacgagcaaatagatgtgcta
actaaagtcaatgctaaactggatcctgaaaaaatggaggaaggaatggggaaagcaacc
ctttcatctatctacgcaatgcaggaaattcaggagaaaagtggcgaagagggtgccaat
agatatattataagtaactgcggaagcgtacaaggtgttcttcagccttttgcttttatg
aaattgtgcggctgggagaaaccaactgcagatgtgatccctctttttgaaacagtaccc
gatctccagaacgcccataatgtaatggaggtgctttataaaaatcctgtatataaggaa
caccttgaaagacgtgggaacaaacaaaccattatgctaggttttagtgatggaactaaa
gatggtggttacctaatggctaactggagtatttataaagctaaagagaccttgacaaag
gtttccagagaatacggaattaaagtagtcttctttgatggtcgtggtggaccacctgca
agaggtggtggtaaaactcaccagttctacgcttcccttggtccaacaattgaaaatgaa
gaaattcaacttactgtacaggggcaaaccattagttctaatttcgggactaaagattcc
tgtacttataatctcgagcagttattaagttcaggggtttccaacgagatctttagtgat
gggaagaatgttcttacggatgaggacagaaaaaccatgaccgaacttgccgaaataagc
tacgagacctataccaattttaaaaagcatcctcgttttattccatatctggaaaaaatg
agtacgttaaaatattatgctaaaaccaatattggtagccgtccttctaaacgtaataaa
tcggccgagctgaatctctcagaccttcgtgcaattcctttcgtaggaagctggagccag
ttgaaacagaatgtacctggattctttggagtaggtactgctatggaaaaactggaaaag
gcaggtgaatttgacagggtaaagagcctgtatcagaattcagaatttttcaaaaccttg
ctggaaaatagtatgatgagtttaactaagtcattctttcctttaaccgcttatatgaaa
gatgacgaggaatttggagaattctggcaactaatctatgaagagtttgagcgtactaaa
agtatgctgttaaaggtaaccggctatgatcacctcatgcagaatcaaccggcgggaaga
gcttccattcaaacacgtgaacgcatagttctgccattacttactattcagcaacatgct
ttaaaaatggttcaggaattaagtaagaatcctgaaaaagaagcggaaaggcttgagatt
tatgaaaaaatggtgaccagatcattatatggtaatattaacgcaagtagaaattcagcc
taa

DBGET integrated database retrieval system