KEGG   Gramella salexigens: LPB144_07705Help
Entry
LPB144_07705      CDS       T04586                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
grl  Gramella salexigens
Pathway
grl03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:grl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    LPB144_07705
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:grl03400]
    LPB144_07705
Enzymes [BR:grl01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     LPB144_07705
DNA repair and recombination proteins [BR:grl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     LPB144_07705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: APG60299
UniProt: A0A1L3J570
LinkDB All DBs
Position
complement(1715007..1717415)
Genome map
AA seq 802 aa AA seqDB search
MSLEDYEKKRDFSKTPEPPSEVNQDAKSRFVIQRHQASRLHYDLRLEIEGVLASWAVPKG
PSMNSKDKRLAIRTEDHPVKYLHFKGSIPKGNYGAGEMSIWDSGVYKSAIDSKSIIEQLN
EGNLKLIFKGEKIKGEFALVKTNSEKGDQWLLIKKGDSYSTDLNYDAEDYIPRSTSKKAK
FRELKNRKTIAPMLATSTAEIFNDPKWIYELKWDGYRIISHIKDTKVHIQSRNGITYNSK
FPALVKDLENIPHDAVLDGELVLLDKNGKSVFQELQNYDGSTKLHLKYYVFDMLFLNGHS
MIDLPLLERKSLIPEVLEDTAVAVYCDHIEGMGTAFYNKAVEAGMEGVIAKKADSVYRPG
IRSEDWLKIKKEESQEAIICGYTTSEKTAFGSLILGIEEDNTLKYIGNCGTGFGRGGKKA
LLQKMKKLQVKTSPFEEKIDLKGREPKWIEPKLVCEVIFSEWTKEGKMRHPVFKAVRKDK
EPEEARLQPSVDKAAEASAGAEDRLEINGRQVSVTNLSKVYWPDSGLRKFDLIDYYLKIS
EIILPYLKDRPQNLHRHPNGINKKGFYQKDTKGFNENWLETTRVYSESSQKDIEYLLCQD
EASLIYMANLGCIELNPWNSRIGNLEKPDYAVIDLDPSSKNNFEEVIEVAQVTYELLKAA
EIGAYCKTSGSTGIHIYIPMGGEYTYNEVRDFTKIICYLIQDALPDLTSMERVVKNRKGK
IYLDYLQNRKGQTLAAPYCVRPKKGAPVSAPIEWKELKSGLRITDFNMNNMPQRLEKKGD
LFHAVLTSEFEMYDAIDRLNSL
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgtctcttgaagattatgaaaagaaacgtgatttttcaaaaacacctgaacctccctct
gaggtaaatcaggatgcaaaatcacgttttgttattcaaagacatcaggcgagtagattg
cattacgatcttagattagagatagagggcgtgcttgccagttgggccgttcccaaaggg
ccttcaatgaattcaaaagataaaaggcttgcaattcgcacagaagatcatccggtgaaa
tatttgcattttaaaggaagtattccaaaaggtaattatggtgctggtgaaatgagcatt
tgggattctggtgtttataagtctgcgatagattcaaaaagtattatagaacaactaaat
gaaggcaatttaaagctcatttttaaaggtgagaagataaagggtgaattcgcgctggtt
aaaaccaattctgaaaagggcgatcaatggttactcattaagaaaggcgattcatattct
accgatcttaattatgatgcggaagattacattccacgatctacgagtaaaaaggccaaa
tttagagagctaaaaaacagaaagactatagcgcctatgcttgccacatctacggccgag
atatttaatgatcctaaatggatctatgagcttaagtgggatggctacaggattatttct
catataaaagacactaaagttcatattcagtccagaaatggaattacctataattcaaaa
tttccggcattggtcaaggaccttgaaaatatccctcacgatgcggtactggatggcgaa
cttgttttgctggataaaaacggcaaatcggtttttcaggaattgcagaattatgatgga
tccacaaaactgcatttaaaatactacgtctttgatatgctattccttaacgggcatagt
atgatagacctgcctttgttggagagaaagagtcttattccggaagtacttgaagatacc
gcagtagcggtttattgcgatcatattgaagggatgggaactgcattttataataaggcg
gtagaagccgggatggaaggcgtaatcgcaaaaaaagcagattcggtttaccggcctggg
attagaagtgaggactggctgaaaattaaaaaagaagaaagtcaggaagctattatttgc
gggtacacaacttcagaaaaaacagccttcggttctttaatattggggatagaagaggat
aatacattaaaatatataggtaattgcgggacaggatttggtaggggaggaaaaaaagcc
ttgcttcaaaagatgaaaaagcttcaggttaaaacttccccatttgaagaaaaaatcgat
ctaaagggaagagagcctaaatggatagaacctaaattggtttgtgaggtgatcttttct
gagtggaccaaagaaggtaaaatgaggcatcctgtatttaaggctgttagaaaggataaa
gaaccggaagaagctaggcttcagcccagtgtggataaagccgctgaagcttctgcgggt
gcagaggaccggcttgaaattaatggcagacaggtaagcgtaaccaatttaagtaaagta
tattggccggattccggattaaggaaatttgatctgatagattattatttaaaaatttca
gaaataatactcccttatttaaaggacaggcctcagaatttacacagacatccgaacggc
ataaataagaagggtttttatcaaaaggacactaaaggatttaatgaaaactggcttgag
accaccagagtttattcggaatcttcccaaaaagatatagaatatttgttgtgtcaggat
gaagccagccttatatatatggcaaacctaggctgtatagaattaaacccatggaactcc
agaatcggaaatttagaaaagcctgattatgctgttatagatcttgatccatcttctaag
aataattttgaagaggtaattgaagttgctcaggtaacctatgagctgcttaaggccgcg
gaaataggtgcctattgtaaaaccagtggttctaccggaatacatatctatattcctatg
ggaggggagtatacttataatgaggtacgtgatttcacaaagatcatttgttacctaatt
caagatgctctacctgatttgacgagtatggaaagagttgtaaaaaacagaaaggggaag
atctatcttgattatctccagaaccggaaaggtcaaaccctggccgctccatattgtgtt
cgtcctaaaaagggagcacctgtttctgcccctatagagtggaaagaattaaaatctggt
ttgaggatcacagacttcaatatgaataatatgcctcaaagacttgaaaaaaaaggtgac
ctttttcatgctgtcttaacttcagaatttgagatgtatgatgcaatagatcgcctgaat
tctttatag

DBGET integrated database retrieval system