KEGG   Gramella salexigens: LPB144_10210Help
Entry
LPB144_10210      CDS       T04586                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
grl  Gramella salexigens
Pathway
grl00240  Pyrimidine metabolism
grl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:grl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    LPB144_10210
Enzymes [BR:grl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     LPB144_10210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: APG60753
UniProt: A0A1L3J6M4
LinkDB All DBs
Position
2277746..2278393
Genome map
AA seq 215 aa AA seqDB search
MFLENTVNHEEQFGWIEVICGSMFSGKTEELIRRLKRAKFAKQNVEIFKPAIDTRYDEEM
VVSHDSNEIRSTPVPSASNIRILADGCDVIGIDEAQFFDDEIVTVCNDLANQGIRVIVAG
LDMDFKGNPFGPMPNLMATAEYVTKVHAVCTRTGNLAQFSYRKAINDELVFLGENEEYEP
LSRAAYFKAMLRERVKKLDVREPEELNFKPKEEDV
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcgaaaatacagtaaatcacgaagagcaatttggctggattgaggttatttgc
ggctccatgttttccggtaaaacggaagaattgatacgcaggctcaaacgggcaaaattt
gccaaacagaatgttgagatctttaaacccgcaatagatactcgttatgacgaagaaatg
gttgtatctcatgattccaatgagatccggtctactccggtaccttctgcttcaaacatc
aggatccttgccgatggctgcgatgttatagggatagatgaagctcagttttttgacgat
gagatcgtaacggtttgtaatgatcttgctaatcaagggatcagggtgatcgttgccggt
ctggatatggactttaaaggcaatccatttgggcctatgcctaatttaatggctacggca
gaatatgtcacaaaggtacatgcggtttgcacccgaacaggaaatcttgcacaattcagt
tatagaaaagccataaatgatgaactggtattccttggagaaaatgaggaatacgaacct
cttagccgtgccgcatattttaaggctatgctgagagaacgggttaaaaaacttgatgtc
agggagcccgaggaattgaattttaaaccaaaagaagaagatgtctga

DBGET integrated database retrieval system