KEGG   Gramella salexigens: LPB144_12975Help
Entry
LPB144_12975      CDS       T04586                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
grl  Gramella salexigens
Pathway
grl00380  Tryptophan metabolism
grl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:grl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    LPB144_12975
Enzymes [BR:grl01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     LPB144_12975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1 SHMT
Motif
Other DBs
NCBI-ProteinID: APG61261
UniProt: A0A1L3J829
LinkDB All DBs
Position
2896747..2898030
Genome map
AA seq 427 aa AA seqDB search
MNFKNTREFARELDAQDKLFKYRNEFIFPKVNGKQVIYFVGNSLGLQPKSAQKYVNEVMT
DWAELAVEGHFYAEKSWWDYHERFSEKLGKIVGANASEVTVMNTLTVNLHLLMVSFYRPS
GKRYKIICEEKAFPSDQYMISSQVRYHGYDPSDAIVEIKKRDGENNFRTEDVIEKIREVG
DECALVLIGGVNYYTGQVFDMEKITKAGHEAGAFVGWDLAHAAGNIELKLSEWNVDFAAW
CSYKYMNSGPGNASGCFINKKYHNKKDIPRFEGWWGHNKERRFLMEQEFQPEPTANAWQI
SNAPILSLAPYLASLEMFDEVGMPALIEKRDKIVAYLEFILHEIDKEVESTFEIITPADQ
SERGTQLSVFLHGEGREIFKYLMDNGVITDWREPNVIRLAPAPFYCSYENMYEFGQILKT
GILNKKK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcaaaaatacccgggaatttgccagggaattggatgctcaggataaactgttt
aaatatagaaacgaatttatatttccaaaggttaatggaaagcaggtgatttactttgtg
ggtaattcacttggtttacaacctaaaagtgctcaaaaatatgtgaatgaagtcatgacc
gattgggctgagcttgcggttgaaggtcatttctatgcagagaaatcctggtgggattac
catgagagattttctgagaaattaggaaagatcgttggtgccaatgcttcggaagtaacc
gtaatgaatactcttacggtgaatttacatctgttaatggtttcgttctacagaccatca
ggcaaacgctataaaataatctgtgaagaaaaggcttttcccagtgatcaatatatgatc
tccagccaggtaaggtatcatggttatgatccttcagatgctattgttgagatcaagaaa
cgggatggagaaaataacttcaggacagaggatgttatcgagaagatcagagaagtagga
gatgagtgtgccctggtcttaattgggggtgttaactattataccggacaggtctttgat
atggaaaagatcactaaagcgggacatgaagcaggagcatttgttggatgggatcttgct
cacgcagctgggaatatagaattaaagcttagcgaatggaatgtggattttgctgcttgg
tgtagttataaatacatgaattcggggcctggaaatgcttcaggttgttttataaataaa
aagtatcataataaaaaagatataccacgatttgaaggttggtggggtcataataaagaa
agacgatttcttatggaacaggaattccaacctgaacctactgcaaatgcatggcaaata
agtaatgctccaattttatcgctggccccttatctggcttcattggaaatgttcgatgag
gtagggatgcctgctttgatagaaaaaagagacaaaattgtagcttaccttgaatttata
cttcacgagatagataaggaagtggaaagtacgtttgagatcattaccccggcagatcag
agtgaaagaggaactcagttatctgtattcctgcacggtgaggggcgagagatctttaaa
tatctcatggataacggcgtgatcacagactggagagaacctaatgttataaggttggct
ccggctcccttttattgctcttatgaaaatatgtatgaattcgggcaaatattaaaaacc
ggaattctgaataaaaagaaataa

DBGET integrated database retrieval system