KEGG   Gramella sp. SH35: C7S20_02330Help
Entry
C7S20_02330       CDS       T05367                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
grs  Gramella sp. SH35
Pathway
grs00010  Glycolysis / Gluconeogenesis
grs00020  Citrate cycle (TCA cycle)
grs00620  Pyruvate metabolism
grs01100  Metabolic pathways
grs01110  Biosynthesis of secondary metabolites
grs01120  Microbial metabolism in diverse environments
grs01130  Biosynthesis of antibiotics
grs01200  Carbon metabolism
Module
grs_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:grs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C7S20_02330
   00020 Citrate cycle (TCA cycle)
    C7S20_02330
   00620 Pyruvate metabolism
    C7S20_02330
Enzymes [BR:grs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     C7S20_02330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H QRPTase_N DUF2118 RnfC_N PYNP_C DUF4258
Motif
Other DBs
NCBI-ProteinID: AVR44193
UniProt: A0A2R3Z1Q1
LinkDB All DBs
Position
complement(472580..474229)
Genome map
AA seq 549 aa AA seqDB search
MAEVIKMPRLSDTMEEGVVAKWLKKKGDKVEEGDILAEIETDKATMEFESFYEGTLLHIG
VEEGEGAPVDALLAIIGEEGEDISDLLAGGGESSEEKTQATQVKEKESEESVEKEDDSEE
GEIPEGVEIINMPRLSDTMEEGTVASWLKKEGDKVEEGDILAEIETDKATMEFESFYSGT
LLKIGVQEGESAKVDSLLAIIGPEGTDVSKIMASGGAKKAKKSTAEPKAEEPSQAPAETE
TTKTESAAKDGGRIFASPLAKKMAEDRGISLSEVKGSGENGRIVKKDIENFKAAPKQETA
AATQETAAKQTTAAVQPYVPAGEESYEEIKNSQMRKTIAKRLGESKFTAPHYYLTIEVNM
ENAMASRKHINEMPDVKVSFNDMVIKASAMALRKHPQVNSQWTGESMKYAKHIHMGVAVA
VEEGLVVPVLKFADQMSLTQIGNNVKDLAGKARNKKIQPSEMEGSTFTVSNLGMFGIVEF
TSIINQPNSAILSVGTIVEKPVVKNGEIVVGHTMKLTLACDHRTVDGATGAAFLATLKTY
MENPVTMLA
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagttatcaagatgccgcgattgagcgacaccatggaagagggtgtggttgcg
aagtggcttaagaaaaaaggagataaagttgaagaaggcgacatcctggccgagatcgaa
accgataaggctacgatggaatttgaatccttttatgaaggtacgctgctccatataggt
gtagaagaaggggaaggagctccggtagatgcacttctcgctatcatcggcgaagaaggt
gaagatataagtgatttgcttgccggaggcggagaatcttctgaagaaaaaacacaggct
actcaggttaaagaaaaagaatctgaagaatctgtcgaaaaagaagatgattctgaagaa
ggggaaattccggaaggtgttgaaataatcaatatgcctcgccttagtgataccatggaa
gaaggaaccgtcgcttcctggcttaaaaaagaaggcgataaagtggaagagggagatatc
ctggccgagattgaaaccgataaggccaccatggaattcgaatctttctattccggaaca
cttctgaaaattggagttcaggaaggggaatctgccaaagtggacagccttcttgcaatt
attggccctgaaggaaccgatgtttcaaaaattatggcttccggtggtgccaaaaaagca
aaaaaatctactgcagaacctaaagccgaagaaccttctcaggctcctgctgaaactgaa
acaacaaaaaccgaatcggctgccaaagacggcggacgaattttcgcttcgccacttgcc
aaaaagatggccgaagatcgtggcataagcctttctgaagtgaaaggttcgggtgaaaat
gggcggattgttaagaaagatattgagaatttcaaagctgctccaaaacaggaaactgct
gccgcaactcaggaaactgctgcaaaacaaactacggctgcggtacagccttatgttcct
gccggggaagaaagctacgaagagatcaagaattctcaaatgcgcaagaccattgcaaaa
cgtttgggagaatcaaaattcactgcaccgcattactatctcactatcgaagtgaatatg
gaaaatgccatggcatccagaaaacatatcaatgaaatgcctgacgtgaaagtgtctttc
aatgatatggtgatcaaagcttcggctatggctcttagaaagcatccgcaggtaaacagc
cagtggaccggggaaagtatgaaatatgccaaacatatccatatgggtgtggcggtagct
gttgaagaaggacttgtggttcctgttttgaaatttgccgaccagatgtcccttactcaa
atagggaacaatgtgaaagaccttgccggaaaggcgagaaacaaaaagatacaaccttca
gagatggaaggaagtacgtttaccgtttctaacctgggaatgtttgggattgtggaattc
accagcatcataaatcagccaaactcggcgattctttcagtcgggactatcgttgaaaaa
cctgtagtgaagaatggtgagatcgttgttggtcataccatgaagctaacgctggcctgc
gaccacagaaccgttgatggagccaccggtgccgcattccttgcgactctgaaaacttat
atggaaaatcctgtgaccatgctggcttaa

DBGET integrated database retrieval system