KEGG   Gramella sp. SH35: C7S20_03195Help
Entry
C7S20_03195       CDS       T05367                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
grs  Gramella sp. SH35
Pathway
grs00564  Glycerophospholipid metabolism
grs01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:grs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    C7S20_03195
Enzymes [BR:grs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     C7S20_03195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like NAD_binding_8 Pyr_redox_2 FAD_binding_3 GIDA Pyr_redox_3 Thi4
Motif
Other DBs
NCBI-ProteinID: AVR44341
UniProt: A0A2R3Z235
LinkDB All DBs
Position
complement(686819..688414)
Genome map
AA seq 531 aa AA seqDB search
MLKHYQFARKRLIRELSEENQWDVLIIGGGATGLGIAVDAATRGYRTLLLEQVDFAKGTS
SRSTKLVHGGIRYLAQGNVELVREALNERGLLAQNAPHLVKKQKFVIPNYAWWEGLYYNF
GLKTYDFLAGKLSMGKSASISLKKIINRFPTLIQEDLRGGVEYMDGQFDDARLAINLAQT
CIENDGYCLNHFKVINILKDKEDMVNGVEAIEEETGKSYRFHSRLVINATGVFVDYIRNM
ANPTAKKIIRASQGVHLVFDKEFFPGKHALMIPKTDDGRVLFAVPWKDKVLVGTTDTLLE
KPSLEPVALEEEIDFILNNFNKYLIRKVSRKDVKSIFAGLRPLAASGDDERKTKEISRGH
KIMLSGNGLLSITGGKWTTYRKMAEDTLDYAIEHKFLPFRECVTENFLIHGATSQKTKDS
HLQLYGSDKTLIFDLINERPELGVRLDEELPFLKAEVVWAVQYEMARTLEDVLARRVRAL
FLDSAAAIRMAPEVAKIMAWELGRDKDWIENQLLEFKEVAKHYMLKKEKTA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
attttgaaacattatcaattcgcaagaaaacgacttattcgtgagctttccgaagagaat
caatgggatgttcttattataggtgggggtgctaccgggctgggaattgcggtagacgcc
gcaactcgtgggtatagaaccttactattggaacaggttgattttgcaaagggaacctca
agccgcagtacaaaattagtgcatggaggcatacgatatctggctcaggggaatgtggag
ctggtaagggaagccctaaacgaacggggactcctggcacaaaatgctcctcatctggta
aaaaagcaaaaattcgttattcctaattatgcgtggtgggaaggattatattacaatttt
ggccttaaaacctatgattttcttgcaggaaaattgagtatgggaaaatctgcaagcatc
agcttaaaaaaaattataaataggtttccaaccctcatccaggaggaccttagaggagga
gtggaatacatggatggccagtttgatgatgccaggctggctattaaccttgcacaaacc
tgcattgaaaacgatggttattgccttaatcatttcaaggttattaatattctgaaggat
aaagaagatatggtaaatggggttgaggccatagaagaggaaaccgggaaatcgtatcgc
tttcattcccgacttgttataaatgctacaggggtttttgtagattacataagaaatatg
gcaaatccgacagctaaaaaaattattagagcgagccagggagtgcatttggtgtttgat
aaagaattttttcctggtaaacatgcgcttatgattcctaaaaccgatgatgggcgtgtt
ctttttgctgttccgtggaaggataaagtgcttgtgggaacaaccgatacccttcttgaa
aaaccaagtctggagccggttgcccttgaagaagagattgattttattttgaataacttc
aataaatatctcatccggaaggtgagccgaaaagatgttaaaagtattttcgcaggtttg
aggccactggcggcttctggagatgatgaaagaaaaaccaaggagatttcccgcggccat
aaaatcatgctttcgggaaatggacttttgagcattaccggtggaaaatggaccacctat
cgaaaaatggctgaagataccctcgattatgctattgaacataaattcctgccctttcgt
gagtgcgtgaccgaaaactttttaattcatggagcaacttcacagaaaacaaaggatagt
caccttcaactttacggaagtgataaaaccttgatttttgatcttattaatgagcggcca
gaactgggagtaagactggatgaagagctaccgtttttaaaggccgaggttgtttgggcg
gttcaatatgaaatggccaggactcttgaagatgtgcttgctcgaagggtaagagccttg
ttcctggattccgcagcggcaataagaatggctcctgaagtagcaaaaataatggcttgg
gagttaggaagggacaaggattggatagaaaaccagcttttggagtttaaggaagttgcg
aagcactatatgctaaaaaaagagaaaaccgcttaa

DBGET integrated database retrieval system