KEGG   Gramella sp. SH35: C7S20_13930Help
Entry
C7S20_13930       CDS       T05367                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
grs  Gramella sp. SH35
Pathway
grs00620  Pyruvate metabolism
grs00680  Methane metabolism
grs01100  Metabolic pathways
grs01120  Microbial metabolism in diverse environments
grs01200  Carbon metabolism
Module
grs_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:grs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    C7S20_13930
  09102 Energy metabolism
   00680 Methane metabolism
    C7S20_13930
Enzymes [BR:grs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     C7S20_13930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 LuxQ-periplasm DUF2121
Motif
Other DBs
NCBI-ProteinID: AVR46273
UniProt: A0A2R3Z7K5
LinkDB All DBs
Position
3134139..3136721
Genome map
AA seq 860 aa AA seqDB search
MTREPRLERFNNNVLAKYQVYNSIFLTLPYDEIRKTGALLPLFLEVCENGFKKNKNPSEI
VERFFNKYGEDPTEEEKIDLLFRFIQYIERQVVLFDAIEDASFPVVHNMDGRGTLRSVKE
EVEATQKIDELKDFLKRFKVRPTLTAHPTQFYPGSVLGIITDLDKAIQKNDLIKIKQLLA
QLGKTPFFKKEKPTPYDEAVSLIWYFENVFYQSASKIHNYIQYNMFGGDEVGNQVINLGF
WPGGDRDGNPFVTTEITLKVAEKLRKTILQNYYKDVRKLKRRLTFRGVHEIMGELEESLY
ESAVSTTGKVRLSLEEFRNKLHQIKDILEKDHRSLFLEEVDDLLNKTKLFGYHFATLDIR
QDSRIHQDVLNEIIEFSSKNNGEFPANFHERTEEEQVEILSNVKGKIDPEKLEEGMGRAT
LSSIYAMQEIQQKNGEEGANRYIISNCGSVQGVLQPFAFMRMCGWKDPDVDVIPLFETVP
DLQDAHNVMEKLYTNPVYKKHLERRGNKQTIMLGFSDGTKDGGYLMANWSIYKAKESLTK
ISREYGIKVVFFDGRGGPPARGGGKTHQFYASLGPTIENEEIQITVQGQTISSNFGTRDS
CTYNLEQLVSAGIANEIFSEGKNRLKEEDRKTMTELADISYKTYSDFKKHPKFIPYLEKM
STLKYYAKTNIGSRPSKRNKSAELNLSDLRAIPFVGSWSQLKQNVPGFFGVGTAIENLEK
KGEFDRVKQLYENSEFFKTLLENSMMSLTKSFFPLTAYMKNDEEFGEFWELIHEEFERSK
RMLLKVTGYDDLMQNQPAGRASIQARERIVLPLLTIQQHALRMVHDLSKDPSKAGDKLEV
YEKMVTRSLYGNINASRNSA
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atgacaagagaacccagattagagagatttaacaacaacgtactcgcaaaataccaggtt
tataacagtatttttcttacgcttccttatgatgaaatcaggaaaactggagcccttttg
ccactgttcctggaagtttgtgaaaatgggtttaaaaagaacaagaatccttcagaaatt
gttgaacggttctttaataaatacggcgaggatcccacggaagaagagaaaatagatttg
ttgttccgttttatccagtatatcgagcgacaggtagtgttatttgatgctattgaagat
gcctctttccccgttgttcataatatggacggtagaggtaccctgcgcagcgttaaggaa
gaagttgaagctactcagaagatcgatgagttgaaagatttcttaaagcgatttaaggtc
agacccactttaacggcacaccctacacagttttatcctggttcagtattgggaataatt
accgatctggataaagccatacaaaaaaatgacctgattaagatcaaacagttattggcc
cagctgggaaaaactccttttttcaaaaaggagaaaccaactccttatgacgaggctgtg
agtctgatctggtattttgaaaacgtcttttaccagagtgccagcaagatccataattat
atacagtataatatgtttggcggtgatgaagtaggtaaccaggttataaatttaggtttc
tggcccggaggggaccgtgatggaaatccgtttgttactactgaaattacgcttaaagtt
gccgaaaaactgcgcaaaaccattctgcagaattattataaagatgtaagaaagttgaaa
cgccgacttactttcagaggcgttcacgagataatgggagaacttgaagaaagtttatat
gaatcggctgtttccaccacagggaaagttcgattaagccttgaagaattcagaaataaa
ctacatcaaatcaaagatatacttgagaaagatcacaggtcattattcttagaagaagta
gatgatctactgaataaaaccaaacttttcggttatcattttgcaacccttgatatcagg
caggattcccggattcatcaggatgttcttaatgaaatcattgaattttccagcaaaaac
aatggtgaatttccggctaatttccatgagcgtaccgaagaagaacaggtggaaattctc
agtaatgtaaaaggcaaaattgatcctgaaaaattagaggaaggtatgggaagggccacg
ctttcttcgatctatgcaatgcaggagatccagcagaaaaatggcgaagagggagcaaac
agatatatcattagtaactgcggaagtgtgcagggagtgcttcagccgtttgcttttatg
agaatgtgtggttggaaagatccagatgtagatgtaatcccgcttttcgaaactgttcca
gaccttcaggatgctcataatgtaatggaaaaactctacaccaatcctgtgtataaaaag
cacctagagcgcagggggaataagcaaactattatgcttggttttagtgacggtactaaa
gatggaggatacctcatggcgaactggagtatttataaagcaaaagagtcccttaccaaa
atatcccgcgaatatggcatcaaagtagttttctttgatggccgtggaggtccgccggca
agaggtggaggtaaaactcaccagttctatgcttctttagggcctacaattgaaaatgag
gaaattcagatcactgttcagggacaaaccattagttctaattttggcaccagggattcg
tgtacttataacctggaacagctggtgagtgccgggattgctaatgagatctttagcgaa
ggaaagaatcgccttaaagaggaagacagaaaaaccatgactgaactggcagatataagt
tataaaacttattccgactttaaaaagcaccctaaattcataccttacctggaaaagatg
agtaccttaaagtattatgccaaaaccaatattggaagccgcccatctaaaaggaataag
tctgctgaactgaatttatctgatcttcgggccataccttttgtaggaagctggagccag
ttaaaacaaaatgttccaggattctttggtgtaggtacggcaatcgaaaacctggagaaa
aaaggcgaatttgatagggtgaagcaactttatgaaaattctgaatttttcaagacactg
ctggaaaacagcatgatgagtctaaccaagtcattctttcctttaactgcatatatgaag
aatgatgaggaatttggagaattttgggagctgatccatgaagaatttgaacgatcaaaa
agaatgttgctgaaggttaccggctatgatgatctcatgcaaaaccagccggccggaaga
gcaagtatccaggcgagggagcgcattgtgcttccgcttctcaccatccagcagcatgcc
ttgcgaatggttcatgacctaagcaaagatccttcaaaagcgggggataagctggaagta
tatgaaaaaatggtcacccgttcgctttatggaaatattaatgcaagtcgaaattcagcc
taa

DBGET integrated database retrieval system