KEGG   Gordonia rubripertincta: GCWB2_01550Help
Entry
GCWB2_01550       CDS       T05629                                 

Definition
(GenBank) Putative DNA ligase-like protein
Organism
gru  Gordonia rubripertincta
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ASR01142
UniProt: A0A222TDA3
LinkDB All DBs
Position
351482..352516
Genome map
AA seq 344 aa AA seqDB search
MPPVAPMLAKAVTAVPQQPDGEIAWSYEPKWDGFRALIFRDGDEVVIGSRGGKDLARYFP
EVVAAVKAELPDKVVLDGEIGVPALIGDTHRLDWDSLAQRIHPAESRVNMLAEKTPAIFI
GFDALALESASVKDEPFEVRREALLRAVGPGGRDRRMHVSRVTGDPSVAEDWFSAFEGAG
LDGVVAKRLDGLYVENKREMLKIKHKRTADCVIFGYRIHKSGRGIGSMLLGLYDDGELRM
VGGAGAFSDAKRVELQEMFEPMRLDPDKPSPGEPTRWRSEKSGEWIPIRPELVAEFAYDQ
MENQRFRHTVKFLRWRPDRDPESCGYDQLEVPLTYDLHDVLEGE
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccgtagccccgatgctggccaaggcggtcaccgccgtgccgcagcagcccgac
ggtgagatcgcctggtcgtatgagccgaagtgggatggattccgcgcgctgatcttccgc
gacggcgatgaggtggtgatcggttcccgcggagggaaagacctggccaggtactttccg
gaggtcgtggccgcggtgaaggccgagctgccggacaaggtcgtcctcgacggcgagatc
ggggtgcccgcactcatcggcgacacgcaccggctcgactgggattcgctggcgcagcgg
atccatcccgccgaatcgcgggtcaacatgctcgccgagaagacgccggcgatcttcatc
ggattcgacgcactcgcactggaatcggcgtcggtcaaggacgagccgttcgaggtccgt
cgggaggcgttgctgcgcgcggtcggacccggtggccgggatcgacggatgcacgtcagc
cgggtgaccggcgacccgtcggttgccgaggactggttctccgccttcgagggtgcaggc
ctcgacggcgtcgtcgccaagcggctcgacggactctacgtcgagaacaagcgcgagatg
ctgaagatcaaacacaagcggaccgcggactgcgtgatcttcggttaccggatccacaag
tcgggcagagggatcggctcgatgttgctcgggctctacgacgacggcgagttgcgcatg
gtcgggggagcgggagcgttctccgacgccaaacgcgtcgagctacaggagatgttcgaa
ccgatgcgcctcgacccggacaaaccgtcgccgggtgagcccacccgctggcggtcggag
aagtcgggggagtggattccgatccgccccgaactggtcgcagagttcgcctacgaccag
atggagaaccagcgcttccgccacaccgtgaaattcctccgctggcgtccggaccgggac
ccggagagttgcggctacgaccagctcgaggtcccgctcacctacgacctgcacgacgtc
ctcgaaggggaatga

DBGET integrated database retrieval system