KEGG   Gordonia rubripertincta: GCWB2_08825Help
Entry
GCWB2_08825       CDS       T05629                                 

Gene name
glpD1
Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
gru  Gordonia rubripertincta
Pathway
gru00564  Glycerophospholipid metabolism
gru01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gru00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    GCWB2_08825 (glpD1)
Enzymes [BR:gru01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     GCWB2_08825 (glpD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 FAD_binding_3 Pyr_redox_2 GIDA NAD_binding_8 HI0933_like AlaDh_PNT_C Pyr_redox Thi4 3HCDH_N Pyr_redox_3 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ASR02574
UniProt: A0A222TH87
LinkDB All DBs
Position
1906664..1908406
Genome map
AA seq 580 aa AA seqDB search
MNTEFNPDRPADMGPLYRAEAWRRFGEEQFDVVVIGGGVVGVGAALDAATRGLRVALVEA
RDIASGTSSRSSKMFHGGLRYLEQLEFGLVREALKERELSLRLLAPHLVKPLPFLYPLTQ
RVWERPYVAAGIFLYDRMGGAKSVPGQKHVTRSGALRVAPALKRSSLIGGIRYYDTVVDD
ARHSLTVARTAANYGAVIRTSTQVIGFLRESDRVLGVRVRDTENGDVTEVRAHCVINAAG
VWTDEVQALSKQRGHFKVRASKGVHIVVPRDRIVSETAIILRTANSVLFVIPWETHWIIG
TTDTDWNLDLAHPAATRADIDYILERVNEVLVTKLTHDDIEGVYAGLRPLLAGEDDETSK
LSREHAVATVAPGLVSIAGGKYTTYRVMAADAVDACNDFIPTRVAPSITERVPLLGADGY
FALINQCEHLGQRYGLHPYRIRRLLNRYGSLIDDVLYYAQEDRSLLAPLAAAPQYLRVEV
VYAAVSEAALHLEDVLARRTRIAIEYSHRGVDCAGEVADLLAPLLGWTTEKRDFEVANYI
ARVEAEVASQQQPDDDSADALRAAAPEARSEILEPVPVPE
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccgagttcaacccggaccggccggcggacatgggcccgctctaccgagccgaa
gcgtggcggcggttcggtgaggaacagttcgacgtggtcgtgatcggcggcggggtggtc
ggcgtgggtgccgcactcgacgccgccacgcgcggtctgcgggtggcgctggtcgaggcc
cgcgacatcgcctcgggcacgtcgagccggtcgtcgaagatgttccacggcggcctgcgc
tacctggaacaactcgaattcgggctggtgcgtgaggcgctcaaggaacgcgagctctcg
ctgcgtctgctggccccgcacctcgtgaaacccctgccgttcctctatccgctgacgcag
cgggtctgggaacggccgtatgtcgcggcggggatcttcctctacgaccgcatgggcggc
gccaaatcggtacccgggcagaaacatgtgacccgttcgggtgccctccgcgtggcgccc
gcgctcaagcgcagctcgctcatcggtggaatccggtactacgacacggttgtcgacgac
gcgcggcacagtctcacggtggcccgcaccgcggccaactacggcgcggtcatccgcacc
tcgacgcaggtgatcggtttcctccgcgaatccgaccgtgtcctcggggttcgcgtccgc
gacaccgagaacggcgacgtcaccgaggtgcgcgcccactgcgtcatcaacgccgccggg
gtgtggaccgacgaagtgcaggcgttgtccaagcagcgcgggcacttcaaggtgcgcgcg
tcgaagggtgtgcacatcgtggtgccgcgcgaccggatcgtcagcgagaccgcgatcatc
ctgcgcaccgccaactcggtgctgttcgtcatcccgtgggagacgcactggatcatcggc
accaccgacaccgactggaacctcgacctcgcgcatccggccgccacccgggccgacatc
gactacatcctcgaacgcgtcaacgaggtgctggtcaccaagctgacccacgacgacatc
gaaggcgtctacgccggtctgcgaccgctgctggcgggtgaggacgacgagacgtcgaag
ctctcgcgtgagcacgccgtcgccaccgtggccccgggtctggtgtcgatcgcgggcggc
aaatacaccacctaccgggtcatggccgccgacgccgtcgacgcgtgcaacgacttcatc
cccacccgggtggcgccgtcgatcaccgagcgggtgccgctgctcggtgcggacggctac
ttcgcgctgatcaaccagtgcgagcatctcggacagcgatacggcttgcacccgtaccgg
attcggcgacttctcaaccgctacggctcgctgatcgacgacgtgctctactacgcccag
gaagacaggtcgctgctcgcgccgctggcagccgcgccgcagtacctgcgcgtcgaagtg
gtctacgcagcggtctccgaggcggcactgcatctcgaggacgtgctggcacgtcgcacc
cgcatcgcgatcgagtactcgcaccgcggcgtcgactgcgccggcgaggtcgccgatctg
ctcgcaccccttctcgggtggaccaccgagaagcgcgacttcgaggtggccaactacatc
gcgcgcgtcgaggccgaggtggcgtcgcaacagcaacccgacgacgattccgccgacgca
ctgcgggcggccgcgcccgaggcgcgttcggagatcctcgagccggtacccgtcccggag
tga

DBGET integrated database retrieval system