KEGG   Gordonia rubripertincta: GCWB2_11205Help
Entry
GCWB2_11205       CDS       T05629                                 

Gene name
geoB5
Definition
(GenBank) Geranial dehydrogenase
Organism
gru  Gordonia rubripertincta
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ASR03038
UniProt: A0A222TIL4
LinkDB All DBs
Position
complement(2466920..2468371)
Genome map
AA seq 483 aa AA seqDB search
MTTDHHSLFIGGTWTEPQSDSRITVYSASTEAVIGSVPEAGKADIDAAVTAARRAFDEAG
GWAEWEPARRADVLDRLADEYDNRAEDIFRAVSQQNGMPIAIARQLEVLPSVLFRYYAGL
VRKQPLEEVRDGMLSKTVTVRRSPVGVVAAIVPWNVPQTLTATKLAPALAAGCTIVIKPS
PETVLDAYLLAEAAQAAGVPPGVVSIVPGGRDIGAYLVSHPGVDKVAFTGSTTGGRAVAK
ACAELLRPVSLELGGKSAAIILDDADLDLSTVGQSLFASTLANNGQVCFLGTRILAPRKR
YNEVVDTFADLITSAPVGDSLDESTLIGPMASKNQRDRVSGYIDVGTAQGARVVVGGAGT
PPGLDQGWFVKPTLFADVDNTATIAREEIFGPVLTVIAHDGDANAIRIANDSDYGLGGTV
WSSDPERAMAVAGAVQTGTIGLNGYAPDPVGPFGGVKSSGIGREFGPEGLAAYQQLKSIY
QFS
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgaccaccactccctattcatcggcggcacctggactgagcctcaatccgac
agccgcatcactgtctattcggcatcgaccgaagccgttatcggatcggtccccgaagct
ggcaaggccgacatcgacgcagccgtcaccgcggccagacgggcattcgacgaggccggt
ggctgggccgaatgggagcccgcacgtcgtgccgacgtcctcgaccgcctcgccgacgag
tacgacaaccgggccgaggacatcttccgcgcagtctctcagcagaacggcatgcccatc
gcgatcgcacgccagctggaagttctaccttcggtgctgtttcgctactacgccggcctc
gtacgcaaacaacccctcgaggaagtacgagacggcatgctctcgaaaaccgtcacagtt
cgacgcagtccggtcggtgtcgtcgccgcgatcgttccctggaacgtcccgcaaaccctc
accgccaccaagctcgcacccgcactcgccgcgggctgcaccatcgtgatcaaaccctcc
cccgaaaccgtgctcgacgcctacctcctcgccgaagccgcacaggccgccggcgtcccg
cccggcgtggtgagcattgtgcccggtggccgcgacatcggggcgtacctcgtttcccac
cccggcgtggacaaggtggccttcaccggttcgaccacgggtggtcgagccgtcgcaaag
gcctgtgccgaactgttgcgcccggtctcgttggaacttggcggaaaatcggccgcgatc
atcctggacgacgccgatctcgacctgagcaccgtcggacagtccctgttcgcatccacc
ctggccaacaacggacaggtgtgcttcctcggcacccggatcctcgccccccgcaagcga
tacaacgaggtcgtcgacaccttcgccgatctgatcacctcagcaccggtcggtgacagc
ctcgacgagagcaccctcatcggaccgatggccagcaagaaccagcgcgatcgcgtcagc
ggctacatcgacgtcggcaccgcccaaggtgcccgcgttgtcgtgggcggagcgggtaca
ccgcccggcctcgaccaaggatggtttgtcaaaccgacattgttcgccgacgtcgacaac
acggccaccatcgcgcgcgaggagatcttcggcccagtcctgaccgtcatcgcccatgac
ggcgacgccaacgccattcgaatcgccaacgactccgactacggcctaggcggcaccgta
tggtccagcgaccccgagcgggccatggcagtcgcgggagcggtacagaccggcaccatc
ggactcaacggatacgcccccgacccggtgggcccgttcggtggcgtcaagtccagcggc
atcggccgcgagttcggccccgaaggactcgccgcctaccagcagctcaagtccatttac
cagttcagctga

DBGET integrated database retrieval system