KEGG   Gordonia rubripertincta: GCWB2_19745Help
Entry
GCWB2_19745       CDS       T05629                                 

Gene name
pstB3
Definition
(GenBank) Phosphate import ATP-binding protein PstB 3
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
gru  Gordonia rubripertincta
Pathway
gru02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:gru00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    GCWB2_19745 (pstB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gru02000]
    GCWB2_19745 (pstB3)
Enzymes [BR:gru01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     GCWB2_19745 (pstB3)
Transporters [BR:gru02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    GCWB2_19745 (pstB3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N Rad17 AAA_22 AAA_29 AAA_16 AAA_15 RsgA_GTPase AAA_18 AAA_33 AAA_23 AAA_30 AAA_28 AAA_5 PRK RNA_helicase
Motif
Other DBs
NCBI-ProteinID: ASR04721
UniProt: A0A222TNK2
LinkDB All DBs
Position
complement(4340246..4341022)
Genome map
AA seq 258 aa AA seqDB search
MAKRLDIKDLNIYYGDFHAVKDVTLEVPPRCITAFIGPSGCGKSTVLRTLNRMHEVTPGA
YAQGSVLLDGEDIYGRNVDPVSVRATIGMVFQRPNPFPTMSIKDNVVAGLRLQGVRNRAE
LDEVAERSLRGANLWDEVKDRLDKPGGGLSGGQQQRLCIARAIAVSPDVLLMDEPCSALD
PISTLAIEDLMGELKKEYTIVIVTHNMQQAARVSDQTAFFNLEGVGQPGQLVEINDTETM
FSNPTKKETEDYISGRFG
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcgcctcgacatcaaagacctgaacatctactacggcgacttccacgcggtg
aaggacgtgaccctcgaggtaccgccgcgctgcatcaccgccttcatcgggccgtcgggc
tgcggcaagtcgacggtgctgcgcaccctgaaccgcatgcacgaggtcaccccgggtgcc
tacgcacagggcagcgtgcttctcgacggtgaggacatctacggccgcaacgtcgatccg
gtcagtgtgcgcgccacgatcggcatggtgttccagcggcccaacccgttcccgacgatg
tcgatcaaggacaacgtcgtcgccggactgcgcctgcagggcgtgcgcaaccgggccgaa
ctcgacgaggtcgccgagcgcagcctgcgcggcgcgaacctgtgggacgaggtcaaggac
cgcctcgacaagccgggcggcggcctttccggcggccagcagcagcggctgtgtatcgcg
cgggcgatcgcggtctcgccggacgtgctgctgatggacgagccgtgttcggcgctcgac
ccgatctcgacgctggcgatcgaggatctgatgggcgagctcaagaaggagtacacgatc
gtcatcgtgacccacaacatgcagcaggctgcccgcgtgagcgaccagaccgccttcttc
aacctggagggcgtcggtcagcccgggcagctcgtggagatcaacgacaccgagacgatg
ttctcgaatccgacgaagaaggagaccgaggactacatctcgggtcggttcggctag

DBGET integrated database retrieval system