KEGG   Gordonia rubripertincta: GCWB2_20400Help
Entry
GCWB2_20400       CDS       T05629                                 

Gene name
davT
Definition
(GenBank) 5-aminovalerate aminotransferase DavT
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
gru  Gordonia rubripertincta
Pathway
gru00250  Alanine, aspartate and glutamate metabolism
gru00410  beta-Alanine metabolism
gru00640  Propanoate metabolism
gru00650  Butanoate metabolism
gru01100  Metabolic pathways
gru01120  Microbial metabolism in diverse environments
Module
gru_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:gru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    GCWB2_20400 (davT)
   00650 Butanoate metabolism
    GCWB2_20400 (davT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GCWB2_20400 (davT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GCWB2_20400 (davT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gru01007]
    GCWB2_20400 (davT)
Enzymes [BR:gru01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     GCWB2_20400 (davT)
Amino acid related enzymes [BR:gru01007]
 Aminotransferase (transaminase)
  Class III
   GCWB2_20400 (davT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Zwilch Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ASR04852
UniProt: A0A222TNT7
LinkDB All DBs
Position
4470606..4471913
Genome map
AA seq 435 aa AA seqDB search
MTAGVDSPTRTHQTASLSPALKQATPVVVDHALGSWIHGTDGRDYLDFTTGIGVTSTGHC
HPHVVEAAQTQCAKVIHAQYTTVMHPPLLELTERLGAVLPAGLDSVFYANSGSEAVEAAI
RLARMATAKPNIIVFQGGFHGRTVAAASLTTAGTRFSAGFSPLMSGVHMAPFPYAFRYGW
DTDTAVDFALRELDYLLQSRVAPNDTAAFLIEPVLGDGGYLPTPPRFLQGLRERADRHGI
LLIIDEVQAGFGRTGKFWGHQHAEGLTPDIIITAKGLASGFPISAIAASTELMSKAWPGS
QGGTYGGNAVAAAAAIATLEVIEAEGLVENARVRGEQLLAGLREVCAPFPGIGDVRGLGL
MAGIEFVTTDAAGNRVPDAPAAVAVQQATTAQGLLTLTCGPSANVVRLIPALVVTADEID
LGVARFGAALHAALG
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgactgccggcgttgactcccccacccgcacccaccagacggcctccctcagccctgcg
ctcaagcaggcgacacccgtcgtcgtcgaccatgcgctggggtcctggatccacggcacc
gacggccgcgactacctcgacttcaccaccggcatcggtgtcaccagcaccggccactgc
cacccgcatgtggtcgaggccgcgcaaacccagtgcgcgaaggtgatccacgcccagtac
acgaccgtcatgcatccgccgctgctcgagctgaccgagcgcctcggtgcggtcctgccc
gccggtctggactcggtcttctacgccaactcgggttcggaggccgtcgaggccgcgatc
cgcctcgcccggatggcgaccgcgaagccgaacatcatcgtcttccagggcggtttccac
ggccgcaccgtcgcggccgccagcctcaccaccgcgggcacccgcttctccgccggcttc
tccccgctgatgagcggcgtgcacatggcgccgttcccgtacgccttccgctacggctgg
gacaccgacaccgccgtcgacttcgcgctgcgcgaactcgactacctcctgcagtcgcgc
gtcgcccccaacgacaccgccgcattcctcatcgagccggtcctcggcgacggcggttac
ctgccgactccgccgcgtttcctgcagggcctccgcgagcgggccgaccgtcacggcatc
ctgctcatcatcgacgaggtgcaggccgggttcggtcgtaccggcaagttctggggccac
cagcacgccgagggcctgacccccgacatcatcatcaccgccaaaggcctggcatcgggg
ttcccgatctcggcgatcgccgcgtcgaccgagctgatgagcaaggcgtggccgggctcg
cagggcggaacctacggcggcaatgccgtggccgcggcggccgcgatcgcgaccctcgag
gtcatcgaggccgagggactcgtggagaacgcccgcgtgcgcggagagcagctgctcgcc
ggcctgcgggaggtgtgcgcaccgttcccgggcatcggcgacgtccggggcctcggcctg
atggccggtatcgagttcgtcaccaccgatgccgccggtaacagggtgcccgacgcccct
gccgccgtcgcggtgcagcaggcgaccacggctcagggcttgttgacgctgacctgcggg
ccgtcggccaacgtcgtccgtctcatccccgcactggtcgtgacggcggacgagatcgac
ctcggtgtcgcgcggttcggcgcggcgctgcacgccgcactaggttag

DBGET integrated database retrieval system