KEGG   Gordonia rubripertincta: GCWB2_22530Help
Entry
GCWB2_22530       CDS       T05629                                 

Definition
(GenBank) Putative DNA ligase-like protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
gru  Gordonia rubripertincta
Pathway
gru03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:gru00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    GCWB2_22530
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gru03400]
    GCWB2_22530
Enzymes [BR:gru01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     GCWB2_22530
DNA repair and recombination proteins [BR:gru03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     GCWB2_22530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ASR05277
UniProt: A0A222TQR4
LinkDB All DBs
Position
4926733..4929216
Genome map
AA seq 827 aa AA seqDB search
MAGGENLEVDGRRISITNLSKVLYPATGTRKYDVIDYYSRIADVMLPHLRDRIVTRKRWP
NGVESTPFFEKDMPDSAPDWVRRYGIQHSERVIEYALAEDRATLVWLAQMAALEIHVPQW
RLPIGPDGERMANRIVFDLDPGPRVPLHETAAVAVEIRNWLGGTTTYPVTSGGKGIHIYA
RLPKPVSSEAARKVAREVANEFARQNSDFITANMSKKIRDDKVFIDWSQNNASKTTLSPY
SLRGREQPWVAAPRTWDEIEDPKIAQLLYTEVLDRVADVGDLLEGLDAPYDDDPATDAGH
DTDQADTEDSDGDIIDPDTLRENITSGDGPAPDDRPTEESQPGQIINLREYRRKRDESKT
PEPFGDENHRQRLRESDEEAGTAPETGPREPIFVIQEHHARRLHYDFRLEHDGVLVSWAV
PKNLPTDPDQNRLAVQTEDHPMDYADFEGDIPAGEYGGGHVSIWDKGTFELEKWRDKEVI
VRLHGEKVQGRYALIRTGDKNWLAHLMTDEPRPIVPDSLSDPRPMLATDDPIDKLNERDW
AFEGKWDGYRLLVRSIGGEFRLTSRSGIDMTKDFPEFAGIADDLGLMDVVLDGEAVAIDS
TGRTNFTLFTSRKHTEEPYTLKLHLFDILYLNGTSLLRKPWSVRRELLEELAPAFRRSPY
VDVPPLLPTPAHAAIEYSREHNLEGVVAKRRDSVYQQGRRSTKWLKHKNWSDIEVVVGGY
RPGRGNRSHTIGSLLLGLPEETGLRYVGRVGTGFTDAQLRSLAEELEPLEISRSPFLDKL
DRPIASSAVWVLPKIVGEVRFMDWTTAGHLRHPSWRGIRRDKFPGDL
NT seq 2484 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcggagagaacctcgaggtcgacggccgccggatctcgatcaccaatctctcc
aaggtgctctatccggcgaccgggacccggaagtacgacgtcatcgactactactcgcgc
atcgccgacgtcatgctgccgcatctgcgcgatcggatcgtcacccgcaaacgctggccc
aacggtgtcgagtcgacgccgttcttcgagaaggacatgcccgacagcgcacccgactgg
gttcgtcggtacggaatccagcacagcgagcgggtcatcgaatacgcgctggccgaggat
cgcgccacgctcgtgtggctggcccagatggcggcgctcgagatccacgtcccgcaatgg
cgactgccgatcggtcccgacggtgaacgtatggccaaccgcatcgtcttcgatctcgac
cccggcccgcgtgtccccctgcacgagaccgcggccgtggcggtggagatccggaactgg
ctgggcggcaccaccacctacccggtgaccagcggcggcaagggcatccacatctacgcc
cgactgcccaaaccggtgagctccgaggcggcacggaaggtcgcgcgcgaggtggccaac
gagttcgcccggcagaacagcgatttcatcaccgccaacatgtccaagaagatccgcgac
gacaaggtcttcatcgactggagccagaacaacgcctccaagaccactctgtcgccgtac
tcgttgcgcggacgcgaacaaccgtgggtcgccgctccccgcacctgggacgagatcgag
gacccgaagatcgcccagttgctctacaccgaggtcctcgaccgcgtcgccgacgtcggc
gatctcctcgaggggctcgacgccccgtacgacgatgatccggccaccgacgccggtcac
gacaccgaccaggccgacacggaagacagcgacggggacatcatcgacccggacacgttg
cgggagaacatcacctccggtgacggtcccgctcccgacgatcgccccaccgaggagtcg
cagccgggtcagatcatcaatctccgggagtaccgccgcaagcgggatgagtccaagacc
ccggagcccttcggcgacgagaaccaccggcagcgcctccgtgaatccgacgaggaggcc
ggcaccgcccccgaaaccggtcctcgcgaaccgatcttcgtcatccaggaacaccacgcg
cggcgcctccactacgacttccgcctcgaacacgacggggtgctggtctcgtgggccgtc
ccgaagaacctgcccaccgatccggaccagaaccggctcgcggtccagaccgaggaccat
ccgatggactatgccgacttcgagggcgacatcccggccggggagtacggtggcgggcac
gtatcgatttgggacaagggcactttcgagctggagaagtggcgggacaaagaggtcatc
gtccgcctgcacggtgagaaggtccagggtcggtacgcactgatacgcaccggcgacaag
aactggctcgcccacctgatgaccgacgagccgcgccccatcgtccccgacagtctcagc
gatccgcggccgatgctcgcgaccgatgacccgatcgacaagctgaacgaacgggactgg
gcgttcgagggcaagtgggatgggtatcggctcctggtgcggtcgatcggtggcgagttc
cggctcacgtcccggtcggggatcgacatgacgaaggacttccccgaattcgcgggcatc
gccgacgatctcgggctgatggacgtcgtcctcgacggcgaggcggtcgccatcgactcg
accggccggacgaacttcacgctgttcacgtcacggaaacacaccgaagagccgtacacg
ctcaagctgcacctgttcgacatcctctacctcaacgggacgtcgttgctccggaaaccg
tggtccgtgcgacgcgaactactcgaggaactcgcgcccgccttccgccggtcgccgtat
gtcgatgtgccgccgctgcttccgacgccggcgcatgcggcgatcgagtacagccgcgaa
cacaacctggaaggcgtcgtcgccaaacgacgcgactcggtgtaccagcagggtcgacgc
tccaccaagtggctcaagcacaagaactggagcgacatcgaggtggtggtcggcggttac
cggcccgggcgcggcaaccgctcgcacaccatcggatcgctgttgctcgggctgcccgag
gagaccgggctccgctacgtgggacgcgtcggcaccggcttcaccgatgcgcaattgcgc
tcgctcgccgaggaactcgagccgctggagatctcccggtcgccgttcctggacaagctc
gaccgccccatcgcgtcgagcgcggtctgggtgctgcccaagatcgtcggcgaggtgcgc
ttcatggactggaccaccgcgggccaccttcgacacccgagctggcgcggcatccgccgg
gacaaattccccggagatctctga

DBGET integrated database retrieval system