Granulicella sp. WH15: FTO74_00335 Help Entry FTO74_00335       CDS       T06415                                  Name (GenBank) oxidase   KO K02277   cytochrome c oxidase subunit IV [EC:7.1.1.9] Organism grw  Granulicella sp. WH15 Pathway grw00190   Oxidative phosphorylation grw01100   Metabolic pathways Module grw_M00155   Cytochrome c oxidase, prokaryotes Brite KEGG Orthology (KO) [BR:grw00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     FTO74_00335 Enzymes [BR:grw01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.9  cytochrome-c oxidase      FTO74_00335 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  COX4_pro DUF5693 DUF4233 Motif Other DBs NCBI-ProteinID:  QHN01995 UniProt:  A0A7L5A3Z3 LinkDB All DBs Position 75632..75946 Genome browser AA seq 104 aa AA seqDB search MNVTNPEHAEHHIVSPREYCFVYGALLIGTIVTVLAAYKDMGVLNPIVALGIACTKAVIV ILFFMHVKYQSRLIKMTVGAGFFTFIVLVMMSLCDYMSRAWGLW NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgaatgtaacaaacccggagcacgccgaacaccatatcgtttcgccgcgcgagtactgt tttgtctacggcgccctgctgatcgggacgatcgtcacggttctggctgcgtataaagat atgggcgtcctgaacccgattgtggcgcttgggattgcctgcaccaaagccgtaatcgtc atcctgttcttcatgcatgtgaagtatcagtcgcggctgatcaagatgacagttggggcg ggttttttcacgtttatcgtcctggtgatgatgtcgctgtgcgattacatgagccgcgcc tggggtctctggtaa

DBGET integrated database retrieval system