KEGG   Granulicella sp. WH15: FTO74_05595
Entry
FTO74_05595       CDS       T06415                                 

Definition
(GenBank) hypothetical protein
  KO
K17106  whey acidic protein
Organism
grw  Granulicella sp. WH15
SSDB
Other DBs
NCBI-ProteinID: QHN02902
UniProt: A0A7D0PPZ8
LinkDB
Position
1320931..1321302
AA seq 123 aa
MRVLRQFGVLLLLLVSCLAPAMACMLPNAEMSAQERACCHMMKDQCGQMEMPASDDCCQK
TPPSVHDNALATRTVAFHPAIVPVIWLAAVEMVSPPPAVVGWIERSSSSPPKSQPGTISI
LRI
NT seq 372 nt   +upstreamnt  +downstreamnt
atgcgagttcttcgccaattcggtgtgctgctcctgctgctggtgtcatgcctggctccg
gcgatggcctgtatgcttcccaatgcggagatgagcgcacaagagcgtgcctgctgtcac
atgatgaaagaccagtgtggacagatggagatgccggcatcagatgactgctgccagaag
actcctccgagcgttcacgataacgcgctggccacaaggacggtagcgttccatccggct
attgtgcccgttatctggctggccgctgttgagatggtgagtccgcctcctgctgtcgtg
gggtggattgagcgttcctcctcctccccgccaaagtcccagcccgggaccatctctatc
ctaagaatctag

DBGET integrated database retrieval system