KEGG   Gryllotalpicola sp. 2DFW10M-5: D7I44_10885Help
Entry
D7I44_10885       CDS       T05660                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
gry  Gryllotalpicola sp. 2DFW10M-5
Pathway
gry03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:gry00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    D7I44_10885
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gry03400]
    D7I44_10885
Enzymes [BR:gry01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     D7I44_10885
DNA repair and recombination proteins [BR:gry03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     D7I44_10885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M LigD_N DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AYG03989
UniProt: A0A387BSE5
LinkDB All DBs
Position
complement(2221502..2223856)
Genome map
AA seq 784 aa AA seqDB search
MQVDGHRLTLSNLDKVMYPETGTTKGDVIRYYTEVAPYLLPYASGRPVTRKRWVNGVGTA
EKPGMVFFQKDLDDSTPEWVARQIIHHKDHDNAYPLLDDVATLTWLAQIASLELHVPQWR
FTDAGERGNPDRMVLDLDPGEGVGLPECVEVAKLVRAVLDDMGLSAVPVTSGSKGIHLYA
PLDGKSTSEEVSEVAHELARSLEADHPDLVISTMKKVDRRGKVMLDWSQNNASKTTVTPY
SLRGRSRPFVAMPRTWREITSGRLRQIELHEVMGLLKKRGDAAEPLMPRGAGKLAAYRSK
RDAGKTPEPVPEGEPQPGSGRSFVIQKHAASRLHYDFRLEHDGVLVSWALPKGVPEPGEK
NHLAVHVEDHPLEYARFAGDIPKGEYGGGHVDIWDHGEYDVEKFRDDEVIAVLHGQPHGG
LGGEPVKVALIATHQGGDEKNWLIHRMELDSRKRKAPARHPSPKKSTRTYKPMLATLGSE
RSVPDDDIAVEMKWDGVRVLAYVRDGKTRLVSRNGIDITTTYPEFGSLAERTGGHDAVLD
GEVIGVDKRGIPDFGLLQQRMRLTKPADVARVAKGVPVKFMLFDVLELDGRDVTDESYDE
RRRMLEESVHSKGDILVPPAFDGTVAEGLARARELRLEGVMVKNPTAPYRPGKRSEAWIK
VKLHRTQEVVVAGWRPGNGRRAGSVGSLLLGIPAKDGLHYVGRVGTGFNDRALDELSALA
KKQARKTTPLVDVPRADASDAHWMSPTLVGEVEFAEWTRDGRLRQPSWRGLRPDKAPSDV
VRES
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggtcgacgggcatcgcctgacgctcagcaacctcgacaaggtgatgtacccggag
accgggaccacgaagggcgacgtgatcaggtactacaccgaggtcgcaccgtacctgctg
ccgtacgcgtccggccggcccgtgacccgcaagcgctgggtaaacggcgtcggcacggcc
gagaaaccgggcatggtcttcttccagaaggacctcgacgactcgacgcccgagtgggtc
gcgcggcagatcatccaccacaaggaccacgacaacgcatacccgctgctcgacgatgtc
gcgacgctcacctggctcgcgcagatcgcgtcgctcgagctgcatgtgccgcagtggaga
ttcacggatgccggcgagcgcggcaacccggaccggatggtgctcgatctggaccccggc
gagggcgtcggcctgcccgagtgcgtcgaggtcgccaagctggtgcgcgcggtgctcgac
gacatggggctgtcggctgtacccgtcacgagcggcagcaaggggatacatctctatgcg
ccgctcgacgggaagtcgacctccgaggaggtctcagaggtcgcgcacgaactggcccgc
tcgctcgaggccgatcaccccgacctcgtcatctcgaccatgaagaaggtcgacaggcgc
ggcaaggtgatgctcgactggagccagaacaacgcgtcgaagaccacggtcacgccgtac
tcgctgcgcgggcggtcacggccgttcgtcgcgatgccgcggacgtggcgggagatcacg
tcagggcggctgcgacagatcgagctgcacgaggtgatggggctgctcaagaagagaggc
gacgccgcggaacccttgatgccgcgcggcgccggcaagctcgcggcctaccgcagcaag
cgcgacgccgggaagaccccggagcccgttccggagggcgagccacagccgggctcaggg
cgctcgttcgtgatccagaagcacgccgcgagcagactgcactacgacttccgcctcgaa
cacgacggcgtgctggtgagctgggcgctgccgaagggcgtgcctgagcccggcgagaag
aaccacctcgccgtgcacgtcgaggaccacccgctcgagtacgcgaggttcgccggcgac
attccgaagggcgagtacggcggcgggcacgtcgacatctgggatcacggcgaatacgac
gtggagaagttccgcgacgacgaggtcatcgcggtgctgcacgggcagccgcacggcggt
ctcggtggcgaaccggtcaaggtcgcgctgatcgccacgcatcagggcggcgatgagaag
aactggctgatccaccggatggaactggattccagaaagaggaaagcaccggcaaggcat
ccgtcgcccaagaaatcgacgcgcacctacaagccgatgctcgcgacgctcggcagcgag
cggtcggtgcccgacgatgacatcgccgtcgagatgaagtgggacggggtgcgcgtgctc
gcgtacgtgcgcgacgggaagacgcggctcgtgagccgcaacggcatcgacatcacgacg
acataccccgagttcggctcgctcgccgagcggacgggcggtcatgacgcggtgctcgac
ggcgaggtgatcggggtcgacaagcgggggattcccgatttcgggctgctgcagcagcgc
atgcgattgacgaagccggccgacgtcgcacgggtcgcgaagggcgtaccggtgaagttc
atgctgttcgacgtgctcgaactcgatggcagggacgtcacggacgagagctacgacgag
cggcgacggatgctggaggaatccgtgcactcgaaaggcgacatcctcgtgccgcccgcg
ttcgacggcaccgtcgcggaaggcctggcgcgggcgcgcgagctgcgcctcgagggcgtc
atggtgaagaatcccaccgcgccgtaccggccgggcaagcgctcggaggcgtggatcaag
gtgaagctgcaccgcacgcaggaggtcgtcgtcgccgggtggcgccccggcaacggccgt
cgcgccggctcggtggggtcgctgctgctggggattccggcgaaggacgggctgcactac
gtgggccgcgtcggcacggggttcaacgaccgggcgctcgacgagctgtcggcgctcgcg
aagaagcaggcgcggaagacgacgccgctcgtcgacgtgcctcgggccgacgcgagcgac
gcgcactggatgtcgccgactctcgtcggcgaggtcgagttcgccgagtggacgcgggac
ggccggctgcggcagccgtcgtggcgcgggctgcgccccgacaaggcgccgtcggacgtc
gtgcgcgagtcgtag

DBGET integrated database retrieval system