KEGG   Gryllotalpicola sp. 2DFW10M-5: D7I44_14825Help
Entry
D7I44_14825       CDS       T05660                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
gry  Gryllotalpicola sp. 2DFW10M-5
Pathway
gry00250  Alanine, aspartate and glutamate metabolism
gry00280  Valine, leucine and isoleucine degradation
gry00310  Lysine degradation
gry00410  beta-Alanine metabolism
gry00640  Propanoate metabolism
gry00650  Butanoate metabolism
gry01100  Metabolic pathways
gry01120  Microbial metabolism in diverse environments
Module
gry_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:gry00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    D7I44_14825 (gabT)
   00650 Butanoate metabolism
    D7I44_14825 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    D7I44_14825 (gabT)
   00280 Valine, leucine and isoleucine degradation
    D7I44_14825 (gabT)
   00310 Lysine degradation
    D7I44_14825 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    D7I44_14825 (gabT)
Enzymes [BR:gry01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     D7I44_14825 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     D7I44_14825 (gabT)
    2.6.1.48  5-aminovalerate transaminase
     D7I44_14825 (gabT)
Amino acid related enzymes [BR:gry01007]
 Aminotransferase (transaminase)
  Class III
   D7I44_14825 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AYG04671
UniProt: A0A387C2B9
LinkDB All DBs
Position
complement(3047609..3048970)
Genome map
AA seq 453 aa AA seqDB search
MTSLAPVDAAAVAGGPSLSQVRKLVTSIPGPRSVELLERKKAAVAAAVGVSVPVAVVAAG
GGVVVDADGNSLIDLGSGIAVTSVGNANPRVVEAVTAQVAAFTHTCFMIAPYEPYVEVAE
ALNRLTPGDFAKRTALFNSGAEAVENAVKIARSYTGRQAVVAFDHAYHGRTNLTMALTAK
SKPYKSGFGPFAPEVYRAPMSYPFRDGLSGAEAAERAISMIEKQVGAENLAAILIEPIQG
EGGFIVPAPGFLPALAAWARQNDVVFIADEVQTGFARTGHMFASEHEGIVPDLITTAKGI
AGGLPLSAVTGRAEIMDAPQVGGLGGTYGGNPLACVAALAAIEAFEHDGLVERAGRIGEV
IAEWAVSVRADEPRIADVRGRGAMVAIELVDPTTGAPDAALAGRVVRYAYEHGVIVLTAG
TYGNVIRFLPPLSIGDELLAEGLGVVREALLAS
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgacttcgctcgctcccgtcgatgccgccgcggtcgccggcggcccgtccctttcccag
gtgcggaagctggtgacgtcgattcccgggccgcgctctgtggagctgctggagcgcaag
aaggcggcggtcgccgccgcggtcggcgtctcggtgcctgtcgcggtcgtcgcggccggc
ggcggtgtggtcgtcgacgccgacggcaactcgctgatcgacctcggctcgggcatcgcc
gtcacctcggtcggcaacgccaacccgcgtgtcgtcgaggcggtcaccgcgcaggtcgcg
gcgttcacccacacctgcttcatgatcgcgccctatgagccctacgtggaggtcgccgag
gctctcaaccgcctcacccccggcgacttcgcgaagcgcaccgccctgttcaactcgggt
gctgaggccgtcgagaacgcggtcaagatcgcccgcagttacacgggccgccaggccgtc
gtcgccttcgaccacgcctatcacggtcgcaccaacctgacgatggcgctcaccgcgaag
agcaagccgtacaagtcgggcttcggcccgttcgctcctgaggtctaccgcgcgccgatg
tcgtacccgttccgcgacgggctgagcggtgccgaggccgccgagcgcgccatctcgatg
atcgagaagcaggtcggggccgagaacctcgcggcgatcctgatcgagccgatccagggc
gagggcggtttcatcgtgccggcacccggcttcctgcccgcgctcgccgcgtgggcgagg
cagaacgacgtcgtgttcatcgccgacgaggtgcagaccggtttcgcacgcaccggccac
atgttcgcgagcgagcacgagggaatcgtgcccgacctgatcaccaccgcgaagggcatc
gcgggcggcctgccgctgtcggccgtcacgggccgtgccgagatcatggatgccccgcag
gtcggcggcctcggcggcacctatggcgggaatccgctcgcgtgcgtcgcggcactcgcc
gcgatcgaggcgttcgagcacgacgggctggtcgagcgcgccggccgcatcggcgaggtc
atcgccgagtgggccgtgtctgtgcgcgccgacgagccgcgcatcgcggacgtccgcggc
cgcggcgcgatggtcgcgatcgagctcgtcgaccccacgaccggtgcgccggatgccgcg
cttgccggccgcgtcgtcaggtacgcctacgagcacggggtgatcgtgctcaccgccggc
acctacggcaacgtgatccgcttcctgcccccgctgtcgatcggcgacgagctgctcgcc
gagggcctcggcgtcgtgcgcgaggccctcttagcgagctga

DBGET integrated database retrieval system