KEGG   Geoalkalibacter subterraneus: GSUB_03545Help
Entry
GSUB_03545        CDS       T03585                                 

Definition
(GenBank) alpha-amylase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
gsb  Geoalkalibacter subterraneus
Pathway
gsb00500  Starch and sucrose metabolism
gsb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gsb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GSUB_03545
Enzymes [BR:gsb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     GSUB_03545
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     GSUB_03545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AJF05824
UniProt: A0A0B5FME7
LinkDB All DBs
Position
complement(783805..787149)
Genome map
AA seq 1114 aa AA seqDB search
MARKKESQIDDNPLWYQDAVIYQVHIKAFADSDGNGIGDFRGLIGKLDYLQSLGVTAIWV
LPFYPSPLRDDGYDIADYKSVNPDYNTLKDFKEFLKQAHARGLRVITELVLNHTSDQHPW
FQRARRAKPGSRYRDWYVWSDAPDKYLDARIIFQDFESSNWSWDPVAKAYYWHRFYSHQP
DLNFENPQVRKEMFKVLDFWFGMGVDGLRLDAVPYLYERDGTNCENLPETHDYLKELRAH
IDEKFDNRMLLAEANQWPEDAVAYFGEGNECHMAFHFPIMPRMYMALQMEDRFPLLDILD
QTPSIPESCQWAIFLRNHDELTLEMVTDEERDYMYRTYATDPRARINLGIRRRLAPLLRN
NRRKIEVMNFLLFSLPGTPIVYYGDEIGMGDNYYLGDRDGVRTPMQWSPDRNAGFSNANP
QKLYLPVISDPEYHYEALNVENQERNPTSLLWWMRRVIAMRKHFKAFGRGSLEMLLPDNP
KVLAFIRRYEDEIILVVVNLSRYCQAVELDLSEFSGMIPEEVFSHNNFPIIRETPYFLTL
GIHDYYWFRLQPERHGRTPEEQSIRLKLSAGQAWHRILEGRSGNRFAENILPAYLDRARW
FRSKARTVRGVSIRDSIAMSINREDVRILLFDVAYSEGASETYMLPVHAVNEKEADNLRQ
QYPQSLIADLQIGEENFFLYDAIYDAAFRQALFNMIRSRRRLKGQRGELAGIPGSRLRTL
LGKGFDPTSSQVMKTEQSNSAMIYDDRLFLKLYRMLENGINPDQEITRLLTEKAKFEHTP
SFGGALEYHGERGEPMAVGLLMGLVSNQGDAWSFSLNVLANYIDRLFSHRSELPPLPDRA
AHLLDITWENIPTGLSEVFGTFYLDMVDRLGQRTAQLHLALASNVQDATWRPEEFSTLYQ
RSVYQSMRSLTRRTFMLLRQNMARVPEAERDQVEHLIEQERDVLIRLSRIMGPKITSMKI
RIHGDYHLGQVLYTGKDFVIIDFEGEPARSLSERRLKRSPLRDVAGMIRSFHYAAMSALR
RHTDDHPTDAEFLHPWLEAWSTHAGAIFLQGYLRTLGDSRLVPDNRAHLKTLLHCFLMEK
AVYELGYELNNRPDWISLPMRGIEMILEEPLEKA
NT seq 3345 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtaaaaaagaatcgcagattgatgacaatcccctctggtatcaggacgccgtc
atctaccaggtgcatatcaaggcctttgccgactcggacggcaacggcatcggggatttt
cgcggcctgatcggcaaactcgactacctgcagagcctcggcgtcaccgccatctgggtg
ctgccattctacccttcgccgctgcgcgatgacggctatgacatcgccgattacaagagc
gttaatcccgactacaacaccctgaaggatttcaaggagtttctcaagcaggcgcacgcc
cgggggctgcgtgtcatcaccgagctggtgcttaatcacacctcggaccagcacccctgg
ttccagcgagcacggcgcgccaagcccggttcgcgctatcgcgactggtacgtctggagc
gacgcgccggacaagtatctcgatgcccgcatcatctttcaggatttcgaaagctcgaac
tggagctgggacccggtcgccaaggcctactactggcatcgcttctattctcaccagccc
gacctcaattttgaaaacccgcaggtccgcaaggagatgttcaaggtgctcgacttctgg
ttcggcatgggagtcgacgggctgcgccttgacgccgtgccctatctctatgaacgcgac
ggcaccaactgtgagaaccttcccgaaacacacgactatctgaaggagctgcgcgctcat
atcgatgagaaatttgataaccgcatgctgctggccgaagccaaccagtggccggaggat
gccgtcgcctatttcggcgagggcaacgaatgccatatggcgtttcatttccccatcatg
ccgcgtatgtacatggcgctacagatggaggaccgcttcccgctgctcgacattctcgat
cagacacccagtattcccgagagctgccagtgggcgatctttctgcgcaaccacgatgag
ttaaccctggagatggttaccgacgaagagcgcgactacatgtaccgcacctacgccacc
gacccgcgcgcccgcatcaatctcggcatccgtcgccggctggcaccgctgctgcgcaac
aaccgacgcaagatcgaggtgatgaacttcctgctgttctccctgccgggaacacccatc
gtctattacggcgacgaaatcggcatgggggacaactactacctgggcgaccgcgacggg
gtacgcaccccgatgcaatggagccccgaccgcaacgccggcttctccaacgccaatccg
cagaaactctacctgccggtcatcagcgatcccgagtaccactacgaggcgctcaatgtg
gaaaaccaggagcgcaaccccacttcgctgctgtggtggatgcggcgcgtgatcgccatg
cgcaagcatttcaaagccttcggccggggcagcctggagatgctgctgcccgacaacccc
aaagtactggcttttatccgccgctacgaagatgaaatcatcctggtggtggtcaacctg
tcgcgctattgccaggcggtggagcttgacctgtcggaattttccggcatgattccggaa
gaggtgttcagccacaacaatttccccatcatccgcgagaccccctattttctgacactg
ggcattcacgactactactggttccggttgcagccggagcgtcacggccgcacgccggaa
gagcagtcaatccgcctgaagctcagcgccggacaagcctggcaccgtattctcgaggga
cgcagcggcaatcgattcgcggaaaacattctgcctgcatatctcgaccgggcccgctgg
ttccgctccaaggcgcgcacggtgcgcggcgtctctatccgcgattccattgccatgagt
atcaaccgggaggatgtgcgcatcctgctgttcgatgtggcctacagcgaaggcgcctcc
gagacctacatgctgccggtccatgcggtgaatgagaaggaagccgacaacctgcgccag
cagtacccccagtccctgattgcagaccttcagatcggagaggagaactttttcctttac
gatgccatctacgacgccgcttttcgacaggctctattcaacatgatccggtcgcggaga
cggctcaaggggcagcggggagaactggccgggattccgggcagccgtttgcggaccttg
ctcggaaaggggttcgatcccaccagctcgcaggtcatgaagaccgaacagagcaacagc
gccatgatttacgatgaccggctgtttctcaagctctatcgaatgctggaaaacggcatc
aaccccgaccaggagatcaccaggctcctgactgaaaaagccaaattcgaacacacgccc
tcttttggcggagccctcgagtatcatggcgaaaggggcgagccgatggcggtaggcctc
ctgatgggactggtttccaaccagggggacgcctggagcttctctctcaatgtcctggcc
aattatatcgaccggctgttcagtcatcgcagcgaattgccgccgctgcccgaccgggcg
gcgcatctgcttgacattacctgggaaaacatacccacggggctctcggaagtgttcggc
accttctacctcgacatggtggaccgactcgggcagcgtaccgcgcaacttcacctggcg
cttgcctccaacgtgcaggacgccacctggcggccggaggaattctccaccctctatcag
cgctcagtctatcaatccatgcgctccctgacgcggcgcaccttcatgctgctgcgccag
aacatggcgcgggtgccggaggcagaacgtgatcaggtcgaacacctgatcgagcaggaa
cgtgatgtcctcatccgcctgtcacgcatcatgggaccgaagatcacctccatgaaaatc
cgtattcatggcgactaccaccttgggcaggtgctctacaccggcaaggatttcgtcatc
atcgatttcgaaggagagccggcacgctccctgagtgaacgacgcctgaagcgctccccc
ctgcgggatgtggccggcatgatccgctcctttcactatgccgccatgagcgccctgcgg
cgccacaccgatgatcatccgaccgatgccgaattcctgcacccctggttggaggcctgg
agcacccatgccggggccatcttcctgcagggctatctgcgcaccctcggcgattcgcga
ctggtgcccgacaatcgcgcccatctcaaaacgctgctgcactgcttcctaatggagaaa
gcggtttacgaactgggctatgagctcaacaaccgcccggactggatttccctgccgatg
cgtggcattgagatgattctggaagagccgttggaaaaggcgtga

DBGET integrated database retrieval system