KEGG   Geoalkalibacter subterraneus: GSUB_04515Help
Entry
GSUB_04515        CDS       T03585                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gsb  Geoalkalibacter subterraneus
Pathway
gsb00010  Glycolysis / Gluconeogenesis
gsb00030  Pentose phosphate pathway
gsb00051  Fructose and mannose metabolism
gsb00052  Galactose metabolism
gsb00680  Methane metabolism
gsb01100  Metabolic pathways
gsb01110  Biosynthesis of secondary metabolites
gsb01120  Microbial metabolism in diverse environments
gsb01130  Biosynthesis of antibiotics
gsb01200  Carbon metabolism
gsb01230  Biosynthesis of amino acids
gsb03018  RNA degradation
Module
gsb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:gsb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GSUB_04515
   00030 Pentose phosphate pathway
    GSUB_04515
   00051 Fructose and mannose metabolism
    GSUB_04515
   00052 Galactose metabolism
    GSUB_04515
  09102 Energy metabolism
   00680 Methane metabolism
    GSUB_04515
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    GSUB_04515
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:gsb01009]
    GSUB_04515
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:gsb03019]
    GSUB_04515
Enzymes [BR:gsb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     GSUB_04515
Protein phosphatases and associated proteins [BR:gsb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GSUB_04515
Messenger RNA biogenesis [BR:gsb03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     GSUB_04515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AJF05972
UniProt: A0A0B5FCS0
LinkDB All DBs
Position
complement(1008736..1009698)
Genome map
AA seq 320 aa AA seqDB search
MKRIAVLTSGGDSSGMNAAVRAVVRSALSSGLEVVGINKGYKGLIDRNYGMMSTRSVSNI
LQRGGTFLQSARCKEMMEEAGQNLAAENLKGMGVEGLVVIGGDGSLRGALSLHRRGIKTI
GIPASIDNDIPYTSMSLGVDTALNNIVYAIDCLKDTASSHDRAFIVEIMGRNCGYLTLVA
AIACGAEHALIPETPFNIGRICENLRKRYREGRDNSIILVAEGVATAQEISNQIKDCIGF
ESRIMVLGHYQRGGSPSSFDRLLGSRFGQGAVQALMEGESGKMIGLSASKMKLTDLEKVL
TGKIRPIDKSMVQLSKSLDF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacgtattgcggtattgaccagcggcggcgacagttccggcatgaacgccgcagtg
cgcgcggtggtgcgttcggccctttcttcgggacttgaggtcgtcggtatcaacaaaggg
tataaagggctgatagaccggaactacggcatgatgagcacccgttcggtcagcaatatt
ctacagcgtggcggcacctttctgcagagtgcgcgctgcaaggagatgatggaagaggcc
ggacagaacctcgcggctgaaaacctcaaaggcatgggcgtcgaaggactggtggtcatt
gggggagacggttccctgcggggcgctctcagcctgcaccggcgcggcatcaaaacgatc
ggcatcccggcctccattgacaatgacatcccctacacatccatgtcgctgggagtcgat
acggcattgaacaacatcgtttacgccatcgactgcctcaaggataccgcatcaagtcat
gatcgtgccttcatcgtcgaaatcatggggcgcaattgtggatacctgacattggttgcg
gctattgcctgcggtgcagaacatgccctgatcccggaaacccccttcaatatcggcagg
atctgcgagaacctgcgcaaacgttaccgcgaagggcgcgacaattcgattatcctggtg
gccgagggagtcgccacggcccaggaaatttcaaatcagatcaaggactgtatcggcttc
gaatcgcgcatcatggtgctggggcattatcagcgcggcggctcgccgtcaagcttcgac
cgcctgctcggatctcgattcggccagggagcagtacaggccctgatggagggagagtcg
ggtaagatgatcggcttatctgcgtcgaagatgaaactgaccgacctggaaaaggtgctg
acaggaaagatccgtcccatcgacaaaagcatggtgcaattgtccaaatctctcgatttt
taa

DBGET integrated database retrieval system