KEGG   Geoalkalibacter subterraneus: GSUB_04730Help
Entry
GSUB_04730        CDS       T03585                                 

Definition
(GenBank) HD family phosphohydrolase
  KO
K03698  3'-5' exoribonuclease [EC:3.1.-.-]
Organism
gsb  Geoalkalibacter subterraneus
Brite
KEGG Orthology (KO) [BR:gsb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:gsb03019]
    GSUB_04730
Enzymes [BR:gsb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     GSUB_04730
Messenger RNA biogenesis [BR:gsb03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     GSUB_04730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HD tRNA_anti-codon HDOD TraI_2 HD_6
Motif
Other DBs
NCBI-ProteinID: AJF06002
UniProt: A0A0B5FCU7
LinkDB All DBs
Position
1051045..1052226
Genome map
AA seq 393 aa AA seqDB search
MKQVYVKDVKERNWVECPFLVRDKIMAMAKNGKPYMTLKLMDRTGEIEGRVWDRVDEFSS
RFEKDDFIFARGKASVYMGKMQLVVQDLERLDEASIDLGDYLPTSDCDPAEMEARLRDKV
ANIGDSHLRRLMESFLADDDFLRRFVMAPAAKAMHHVYLGGLLEHSLAVADLVDDVSGRY
PGLNRDLLVTGALLHDVGKIDELCYARSFDYTDEGKLIGHIVIGTELVEDKIRDLEGFPR
KTAVLLKHLLLSHHGQYEYGSPKRPKTVEAVILNFLDDLDSKINGVRTHIEREPDNPSGW
TSYHRLYDRYFFKDATPANEVLSDQADSRPSTDQARTTPQPAVKPAAAPAKKDATQSNKE
DRPRRRANKGFTLGEQLRGKSLDLFSTENSEKE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcaggtttatgtcaaggatgtaaaggaacgtaactgggtggagtgcccctttctg
gtgcgcgataaaatcatggcgatggccaagaacggcaaaccctacatgacgctcaagctc
atggatcgcaccggtgagatcgaaggacgggtctgggaccgggtcgatgaattctccagc
cgttttgaaaaggacgatttcatcttcgctcgcggcaaggcgagtgtctacatgggcaaa
atgcagctggtcgtgcaggaccttgagcgcctcgatgaggcgagtatcgatctgggcgac
tacctgccgacctccgactgtgatcctgcggagatggaggccaggctgcgcgacaaagtt
gcaaacatcggcgacagccatctgcgccgcctgatggagagcttcctggccgatgacgat
tttctcaggcgttttgtcatggcccctgcggcaaaggccatgcaccatgtctaccttggc
gggttgctggaacacagcctggcggtggccgaccttgttgacgacgtcagcgggcgctat
cccggcctcaatcgcgatctgctggtgaccggcgctctgctgcacgatgtgggcaaaatc
gatgaattgtgctatgcgcgatccttcgactatacagatgaaggcaagctgatcggccat
atcgtcatcggcacagaattggtcgaagataaaatccgtgaccttgaagggttcccccgc
aaaaccgcggtgctgctcaaacatctgcttctgtcgcatcacgggcagtacgagtatggt
tcccccaaacggcccaagacggttgaagcggttatcctgaatttcctcgacgatctggac
tccaagatcaacggcgtgcgtacccatattgaacgtgagccggacaatccgagcggttgg
accagctatcaccggctttatgatcgatactttttcaaggacgcaacgccggccaatgaa
gttctgtccgatcaggctgactcccggccatcgacagaccaagcgcgtaccacgccgcag
cctgccgttaaacctgcggctgcgcccgcgaagaaagacgccacgcaaagcaataaagag
gatcgcccccggcgccgcgccaataaaggcttcactctgggcgagcagctgcgcggcaaa
agtctggatctgttttccactgaaaattccgagaaggagtag

DBGET integrated database retrieval system