KEGG   Geoalkalibacter subterraneus: GSUB_10450Help
Entry
GSUB_10450        CDS       T03585                                 

Definition
(GenBank) 3-hydroxyacyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
gsb  Geoalkalibacter subterraneus
Pathway
gsb00061  Fatty acid biosynthesis
gsb00780  Biotin metabolism
gsb01100  Metabolic pathways
gsb01212  Fatty acid metabolism
Module
gsb_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:gsb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    GSUB_10450
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    GSUB_10450
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:gsb01004]
    GSUB_10450
Enzymes [BR:gsb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     GSUB_10450
Lipid biosynthesis proteins [BR:gsb01004]
 Fatty acid synthase
  Component type
   GSUB_10450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT
Motif
Other DBs
NCBI-ProteinID: AJF06892
UniProt: A0A0B5FFG7
LinkDB All DBs
Position
complement(2247102..2247545)
Genome map
AA seq 147 aa AA seqDB search
MTLDINEIMKRLPHRYPFLLVDRIEELVKGERVVGVKNVTINEPFFQGHFPGHPVMPGVL
IIEAMAQVGGVFAIISDEIGSDMVTYFTGIDKARFRKPVRPGDVLRMHLELLNCKRGLYC
FRGKAYVDDKLVAEADLKATFAPKENG
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgacattggatatcaatgaaatcatgaagcgcctccctcaccgttatccttttctgctc
gttgaccgcatagaggaactggtcaaaggtgagagggtggtgggggttaagaatgtgacc
atcaacgaacccttttttcaagggcacttccccggtcatccggtcatgcccggtgtgctg
attatcgaagccatggcacaggtgggcggtgtctttgccatcatcagtgatgaaatcggc
tccgacatggtgacgtatttcaccggcattgataaagcgcgttttcgtaaaccggtccgt
cctggcgatgtgctgcgcatgcatcttgaactgctgaactgtaaacgcggcctgtattgt
ttcagaggcaaagcctatgtggacgataaacttgtcgccgaagccgacctcaaagccacc
ttcgctccgaaagaaaacggttga

DBGET integrated database retrieval system