KEGG   Geoalkalibacter subterraneus: GSUB_11385Help
Entry
GSUB_11385        CDS       T03585                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
gsb  Geoalkalibacter subterraneus
Pathway
gsb00250  Alanine, aspartate and glutamate metabolism
gsb00410  beta-Alanine metabolism
gsb00430  Taurine and hypotaurine metabolism
gsb00650  Butanoate metabolism
gsb01100  Metabolic pathways
gsb01110  Biosynthesis of secondary metabolites
gsb01120  Microbial metabolism in diverse environments
gsb02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:gsb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    GSUB_11385
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GSUB_11385
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GSUB_11385
   00430 Taurine and hypotaurine metabolism
    GSUB_11385
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    GSUB_11385
Enzymes [BR:gsb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     GSUB_11385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS OKR_DC_1
Motif
Other DBs
NCBI-ProteinID: AJF07046
UniProt: A0A0B5FTX7
LinkDB All DBs
Position
complement(2451888..2453531)
Genome map
AA seq 547 aa AA seqDB search
MPRSKESARANLENLYRIFTVPEAPDSTLGRIDQAISDNVTGFLQKHIVALENSITDIEK
SFDDPKIPEEPTFVSDYTEFIKEKLVAQSVHTAAPGFIGHMTSALPYFMLPLSRIMIALN
QNLVKVETSKAFTPMERQVLAMLHRLIYSESDAFYHRWIHDSRYALGAFCSGGTIANITA
LWAARNQLCSPSGNFRGITNEGFFRAMQHLGCQGLAVLVSRRRHYSLGKAADLLGIGREN
LVLVETDDRNRINMAALREQCRRIQDKGIRPLSLIGIAGTTETGNVDPLEEMADLAEEIG
CHFHVDAAWGGPTLFSEKYRSLLKGIERADSVTIDAHKQLYVPMGAGMVLFKDPAALSSI
EHHAAYIIRHGSKDLGSHTLEGSRPGKAMLVHAGLSIIGRKGYELLIDQGIERARRFAEM
VQEHPDFELVTAPELNILTYRYNPASVQEALAHADAETVREVNELLDKMTKRIQKRQREA
GKTFVSRTSLTPERYRGQTIIVFRVVLANPLTTEDILASVLEEQCEWARHPEVSPLLDQL
QEMTAAA
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgcccagatcaaaagagtcagcacgcgctaatctggagaacctctatcggattttcact
gttcctgaagcaccggattccaccctggggcgcatcgaccaggccatatccgacaatgtg
accggttttctccagaagcatattgtcgctttggaaaacagcatcaccgacatcgagaaa
tctttcgatgatccgaaaatacccgaagagccgaccttcgtatccgactataccgagttc
atcaaagagaagctggtggctcagtcggtccacaccgcggcgcccgggtttatcggccat
atgacttcagccttgccttatttcatgctgccgctgtcacgcatcatgatcgcgctcaac
cagaacctggtgaaggttgaaacttccaaggcatttacccccatggaacggcaggtgctg
gccatgctgcaccgcctgatctattccgagtcggacgcattttaccatcgctggattcat
gacagccgttacgcgctgggtgcgttctgttcgggggggacaatcgccaatatcacagct
ctgtgggccgcgcgcaatcaactgtgcagcccctccggaaatttccgcggtatcaccaat
gaaggattctttcgggcgatgcagcaccttggatgccaggggctcgctgtgttggtctcc
aggcgaaggcattattcgctgggcaaggctgcggatctgcttgggatcggccgcgagaac
ctggttctggtcgaaacggatgatcgaaaccggatcaatatggctgccttacgcgaacag
tgccgacgcattcaggacaaggggatccggcctttgagtctgatcggcattgccggaaca
actgagaccggcaacgtggaccctcttgaagagatggcggacctggccgaggaaatcggc
tgccattttcatgtggacgccgcctggggcggcccgacactgttctcagagaaatatcgc
agtcttctgaaggggatcgagcgggccgattcggtgaccatcgatgcacacaaacaactc
tatgtgccgatgggggcggggatggtgctgtttaaagatcctgccgccctttcatccatc
gaacatcatgccgcttatatcatccggcacggttcaaaagacctgggcagccataccctg
gagggttcgcgtcccggcaaagccatgctggttcatgcggggctgtccattatcggacgc
aaaggttatgaactgttgatcgaccaggggattgaacgggcacgccgttttgccgagatg
gttcaagaacatccggacttcgaactggtgacggcaccggaactcaatattttaacttac
cgctataatccagcctctgtgcaggaggctttggcacatgctgacgcggagacggttcgt
gaagtcaacgaactgctggataaaatgaccaagcggattcagaagcggcagcgtgaggcc
ggaaaaacctttgtttcccgaaccagccttacgcccgagcgttatcgcggccagaccatc
atcgtgtttcgggtggtgctggccaatccactgaccaccgaggacattctggcctcggtg
cttgaagagcagtgtgaatgggctcgtcatccggaggtctccccgctgctcgatcagttg
caggagatgacggccgcggcctga

DBGET integrated database retrieval system