KEGG   Geoalkalibacter subterraneus: GSUB_12395Help
Entry
GSUB_12395        CDS       T03585                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
gsb  Geoalkalibacter subterraneus
Pathway
gsb00790  Folate biosynthesis
gsb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gsb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GSUB_12395
Enzymes [BR:gsb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     GSUB_12395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind PEP_hydrolase DUF561
Motif
Other DBs
NCBI-ProteinID: AJF08034
UniProt: A0A0B5FTN1
LinkDB All DBs
Position
complement(2664139..2664924)
Genome map
AA seq 261 aa AA seqDB search
MGILNITPDSFSDGGCYLDPDCALKQARNMVEQGVDLIDIGGESTRPGSTGVDEEEEVRR
VVPIVERIAAQCAVPISVDTTKSRVAHEAILAGAEFINDVSGLRFDSEMARVAAQTGAGL
FLMHTRGRSDIMQKRTDYADLLGDVCRYLAEGIELAYAAGVEEDRIAVDPGVGFGKDAAG
NLEILRRLAELHCLGRPILLGTSRKAFLGKILDRPQPCERLFGTVATTALGVAQGARIFR
VHDVAPNRDAALTAWAIHPYV
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggggattctcaatatcacccccgattctttctcggatggggggtgctacctcgatccg
gattgcgccctgaaacaggctcggaacatggtcgagcagggggtcgatctcatcgatatc
ggaggggaaagcacccgcccgggatctacaggggttgacgaagaggaggaagtgcggcgg
gtagtccccatcgttgaacggatcgccgcacaatgtgctgttccgatttcggtggatacc
acaaaaagccgcgttgcccatgaggccattcttgccggcgcggaatttatcaacgatgtc
agtgggctgcgttttgactctgaaatggcgcgcgtcgccgcgcagaccggcgccggattg
ttcctcatgcatacccgagggcgctcggacatcatgcagaaacggacggattatgctgat
ttgctcggggatgtatgccgctacctggccgaggggatcgaacttgcatatgccgccggg
gttgaagaggatcgcatcgccgtagacccgggtgtcggattcggcaaggacgcagccggc
aacctggaaatcctgcgtcgccttgcagagcttcattgcctggggcggccgatcctgctg
ggcacctcacgtaaagctttcctcggtaaaattctcgaccgccctcagccgtgcgagcgt
ctgttcggaactgtcgctactacggctctcggcgttgctcagggggcacgtattttccga
gtgcatgatgtcgccccgaatcgtgatgccgctttgacagcctgggcgatccacccttat
gtatga

DBGET integrated database retrieval system