KEGG   Geobacillus stearothermophilus: GT50_01655Help
Entry
GT50_01655        CDS       T04043                                 

Definition
(GenBank) peptide ABC transporter ATPase
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
gse  Geobacillus stearothermophilus
Pathway
gse02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:gse00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    GT50_01655
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gse02000]
    GT50_01655
Transporters [BR:gse02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    GT50_01655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY SMC_N AAA_21 TniB AAA_22 AAA_25 IstB_IS21 Mg_chelatase PhoH AAA_16 RsgA_GTPase NACHT AAA_29 AAA_7 NB-ARC AAA
Motif
Other DBs
NCBI-ProteinID: ALA69019
UniProt: A0A0K2H4P8
LinkDB All DBs
Position
complement(307966..308991)
Genome map
AA seq 341 aa AA seqDB search
MEKQPLLEIDRLRVSFQIDGDYYAAVDDVSLTIRENEVVALVGESGCGKSALALSIMGLH
PPEKTKVEGRLQFKGTNLLSLSVSELNRIRGKEIGMIFQDPLTALNPLMTVGRQIEESMD
YHLRLSGAEKKKRTIRLLERVGIPEPEKVYHRYPHELSGGMRQRVVIAIAVACEPALLIA
DEPTTALDVTIQAQIMGLLKELQQQMKTSIILITHDLGIVAEMADRVAVMYAGEIVEWAD
VDTIFHRPLHPYTRSLLQSIPSAQTKKERLHVIQGIVPPLHKLPRRGCRFQPRISWIGAD
KHEPDPKLREVEPGHWVRCTCYQHFYFPDDQTVGGVGYGAS
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaaacaaccattgttggaaattgaccgattgcgggtttcgtttcagatcgacggc
gactattatgcggcagtagatgatgtttccttgacgatcagggaaaacgaagtcgtcgct
cttgtcggcgagtcgggatgcggaaaaagcgccctcgccctttcgatcatggggctgcac
ccgccggagaagacgaaggtagaaggacgtctgcagtttaaagggacgaacttgctgtcg
ttatccgtttccgaattgaaccgaatccgcggcaaagaaatcgggatgattttccaagat
ccgttgacggcgctcaatccactcatgaccgtcggccggcaaatcgaggaaagcatggat
tatcatttacggctgtcgggggcagaaaaaaagaagcgaacgatccgtttgcttgagcgg
gtcggcattcctgaaccggaaaaagtgtaccatcgctatccgcatgaactgtccggagga
atgcggcagcgggtcgtgattgcgatcgccgtcgcctgcgagccagccttattgatcgcc
gatgagccgactacagcgcttgacgtgacgattcaggcgcaaattatggggcttttgaaa
gagctgcagcagcaaatgaaaacgagcattattttgatcacgcacgatttagggatcgtg
gcggaaatggcggaccgtgtggcggtcatgtatgccggggaaatcgttgaatgggcggac
gtcgatactattttccaccgcccgcttcatccatacactcgctcgttgttgcagtcaatc
ccgtccgcgcagacgaaaaaggaacggcttcacgtcattcaaggaatcgttcctccgctg
cataagctgccgcggcgaggctgccgcttccagccgcgcatcagctggattggggcggat
aagcacgaaccggatccgaagctgcgggaagtggagccggggcattgggtgcgttgcaca
tgttaccaacatttttattttcccgatgatcaaacggtaggtggagtcggctatggcgct
tcttaa

DBGET integrated database retrieval system