KEGG   Geobacillus stearothermophilus: GT50_04305Help
Entry
GT50_04305        CDS       T04043                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
gse  Geobacillus stearothermophilus
Brite
KEGG Orthology (KO) [BR:gse00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GT50_04305
Enzymes [BR:gse01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     GT50_04305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_binding_2 DAO FAD_oxidored AlaDh_PNT_C NAD_binding_7 Thioredoxin_4 FAD_binding_3 Thi4 Glutaredoxin NAD_binding_8 FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ALA69507
UniProt: A0A0K2H651
LinkDB All DBs
Position
complement(802480..804009)
Genome map
AA seq 509 aa AA seqDB search
MLLDADIKAQLAQYLQLLENDIVLTVSAGDDNVSRDMLALIDELTAMSPKIKVEKAKLER
TPSFSVNRVGENTGITFAGVPLGHEFTSLVLALLQVSGRPPKVSQDVVDRIQQIRGKHHF
ETYVSLTCHNCPDVVQALNIMSVLNPNISHTMIDGAAFKEEAEQKGIMAVPTVFLNGKLF
ASGRMSLEDILAKLGSAPDASSFADKEPFDVLVIGGGPAGATAAIYAARKGIRTGIVAER
FGGQILDTLGIENFISVKYTEGPKLAASIEEHVKQYNVDIMSSQRAKRLEKKDLIEVELE
NGAVLKSKTVVIATGARWRNLGVPGEEEFKNKGVAYCPHCDGPLFEGKHVAVIGGGNSGV
EAAIDLAGIASHVTLLEFAPELKADAVLQDRLYSLPNVTVIKNAQTTEITGTDKVNGLTY
IDRETGEEHHIELQGVFVQIGLVPNTEWLEGTVERNRFGEIIVDKRGATNIEGVFAAGDC
TDSAYKQIIISMGSGATAALSAFDYLIRH
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgctgctggatgctgacatcaaggcgcaactagctcagtatttgcaattgcttgaaaat
gatattgtcttgacggtaagcgcgggagacgacaacgtttcccgcgatatgcttgcttta
atcgatgaattaacggcgatgtcgccgaaaatcaaagtggaaaaagcgaagctggaacga
acgccaagcttcagcgtcaatcgggtcggcgaaaacaccggcatcaccttcgccggcgtg
ccgctcggccatgaatttacgtccctcgttttggcgctgcttcaagtgagcgggcggccg
ccgaaagtcagccaagacgtcgtggaccgcattcaacaaatcaggggcaaacatcatttt
gaaacgtacgtcagcctgacatgccacaactgcccggacgtcgtgcaagcgctcaacatc
atgagcgtgttaaacccgaacatttcgcatacgatgatcgacggggcggcgtttaaagaa
gaagcggagcaaaaagggattatggccgtaccgacggtgtttttaaacggcaaactgttc
gcgagcggccgcatgtcgcttgaagatatcctcgccaaattagggagtgctccggacgct
tcttccttcgccgacaaagagccgtttgatgtgctggtgatcggcggcggccctgcaggt
gcgacagcagccatttacgcagcgcgcaaaggcattcgcactggcattgtcgcggagcgc
ttcggcggacaaattttagatacgctcggcattgaaaactttatcagcgtcaaatatacg
gaaggaccgaagcttgcggccagcattgaagaacatgtaaagcaatacaatgtcgacatc
atgagctcgcagcgggcaaaacggctcgagaaaaaagacttgattgaagtcgagctggaa
aacggcgctgtgttgaaaagcaaaacagttgtcatcgcaacgggcgcccgttggcgcaac
cttggcgtgccgggcgaggaagagttcaaaaacaaaggggtcgcctattgcccgcactgc
gacggcccgctgttcgaagggaagcacgtggcggtcatcggcggcgggaactctggagtc
gaagcggcgattgacctcgctggcatcgccagccatgtgacgctgctggagttcgcccct
gaactcaaggctgatgctgttttgcaagatcgtttgtacagcttgccgaacgtaacggtg
attaaaaacgcgcaaacgacggaaatcaccggcacggacaaagtcaacggcttgacgtac
attgaccgggaaacaggagaagaacatcatatcgaattgcaaggcgtgttcgtgcaaatc
ggccttgttccgaacaccgaatggttggaaggaacggtggaacggaatcgcttcggtgaa
atcattgttgataaacgcggcgcaacgaacattgaaggcgtctttgccgcaggcgactgc
acagacagcgcctataagcaaatcattatctcgatgggctcgggtgcaaccgcggcgtta
agcgcgtttgattatttgattcgccattaa

DBGET integrated database retrieval system