KEGG   Geobacillus stearothermophilus: GT50_05190Help
Entry
GT50_05190        CDS       T04043                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gse  Geobacillus stearothermophilus
Pathway
gse00010  Glycolysis / Gluconeogenesis
gse00030  Pentose phosphate pathway
gse00051  Fructose and mannose metabolism
gse00052  Galactose metabolism
gse00680  Methane metabolism
gse01100  Metabolic pathways
gse01110  Biosynthesis of secondary metabolites
gse01120  Microbial metabolism in diverse environments
gse01130  Biosynthesis of antibiotics
gse01200  Carbon metabolism
gse01230  Biosynthesis of amino acids
gse03018  RNA degradation
Module
gse_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:gse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GT50_05190
   00030 Pentose phosphate pathway
    GT50_05190
   00051 Fructose and mannose metabolism
    GT50_05190
   00052 Galactose metabolism
    GT50_05190
  09102 Energy metabolism
   00680 Methane metabolism
    GT50_05190
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    GT50_05190
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:gse01009]
    GT50_05190
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:gse03019]
    GT50_05190
Enzymes [BR:gse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     GT50_05190
Protein phosphatases and associated proteins [BR:gse01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GT50_05190
Messenger RNA biogenesis [BR:gse03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     GT50_05190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Peripla_BP_1 NAD_kinase PucR
Motif
Other DBs
NCBI-ProteinID: ALA69676
UniProt: A0A0K2H7J0
LinkDB All DBs
Structure
PDB: 

Position
complement(981612..982571)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRKAIYHGVEVYGIYHGYAGLIAGNIKKLEVGDVGDI
IHRGGTILYTARCPEFKTEEGQKKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVVEVMGRHAGDIALWS
GLAGGAETILIPEADYDMDDIIARLKRGHERGKKHSIIIVAEGVGSGVDFGRQIQEATGF
ETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLEGKGGRCVGIQNNQIVDHDIAEAL
AKTHTVDQRMYTLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggattggtgtgttgacaagcggcggcgactcgccgggcatgaatgcggccatt
cgcgctgtcgtccgcaaagcgatttaccatggggtggaagtgtacggaatctaccacggg
tatgccgggttgatcgccggcaatatcaaaaagctggaagtcggggacgtcggggacatc
atccatcgcggcggcaccatcctttataccgcgcgctgcccggagtttaagacggaagaa
ggacagaaaaaggggatcgagcagctgaaaaagcacggcattgaagggctggtcgtcatc
ggcggcgacgggtcgtatcaaggggcgaaaaaattgacggagcacggcttcccgtgcgtc
ggcgtgcccgggacgatcgacaacgacattccaggcaccgatttcacgatcggttttgac
accgcgctcaatacggtcattgacgccattgacaaaatccgcgacacggcgacgtcgcat
gagcggacgtacgtcgtcgaagtgatgggccgccatgccggcgatattgcgctatggtcg
gggcttgccggaggggcggagacgattttgattccggaagcggactacgacatggacgac
atcatcgctcgcttgaagcgcggccatgaacgcggcaaaaaacacagcatcatcatcgtc
gccgagggagtcggcagcggcgtcgacttcggccggcaaattcaagaggcgaccggcttt
gagacgcgcgtgacggtgcttggccacgtgcagcgcggcggatcgccgacggcgtttgac
cgcgtgttagcgagccgcctcggcgcccgtgcggtcgagctgctccttgaaggcaaaggc
ggccgctgcgttggcattcaaaacaaccaaatcgttgaccatgacattgccgaagcgttg
gcgaaaacacatacggtcgatcagcggatgtatacattgtcgaaagagctgtcgatttaa

DBGET integrated database retrieval system