KEGG   Geobacillus stearothermophilus: GT50_06715Help
Entry
GT50_06715        CDS       T04043                                 

Definition
(GenBank) hypothetical protein
Organism
gse  Geobacillus stearothermophilus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2553
Motif
Other DBs
NCBI-ProteinID: ALA69933
UniProt: A0A0K2H7K7
LinkDB All DBs
Position
complement(1260828..1261064)
Genome map
AA seq 78 aa AA seqDB search
MALQTTRIDVTDRIIGKLNGRSLELYEEGELIGRLPLPAAVPLKNGYTEQNGRIYKQVTA
TVEPDQKYVDCDGEAGWC
NT seq 237 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgcaaacgacgcgcatagatgtcacggaccggatcatcggcaaactgaacggc
cgctcgctggagctgtacgaggaaggagagctcatcgggcgccttccgcttccggcggcc
gtcccgttgaaaaatgggtataccgaacaaaacggaagaatttacaaacaggtgaccgct
accgttgagccggaccaaaaatatgtcgattgcgacggggaagcgggctggtgttga

DBGET integrated database retrieval system