KEGG   Geobacillus stearothermophilus: GT50_07605Help
Entry
GT50_07605        CDS       T04043                                 

Definition
(GenBank) chemotaxis protein CheY
  KO
K07692  two-component system, NarL family, response regulator DegU
Organism
gse  Geobacillus stearothermophilus
Pathway
gse02020  Two-component system
gse02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:gse00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GT50_07605
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    GT50_07605
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:gse02022]
    GT50_07605
Two-component system [BR:gse02022]
 NarL family
  DegS-DegU (multicellular behavior control)
   GT50_07605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg GerE Sigma70_r4_2 HTH_23 Sigma70_r4 HTH_38 SnoaL_2 Sulfotransfer_4
Motif
Other DBs
NCBI-ProteinID: ALA70086
UniProt: A0A0K2H8P6
LinkDB All DBs
Position
complement(1426868..1427542)
Genome map
AA seq 224 aa AA seqDB search
MKTRIAIIDDHQLFREGIKRILEFEGDFEVVAEGSDGSEALSIVETYRPDLVLMDINMPD
INGVEATKQLIEAYPDTKVVVLSIHDDENYVMRALQTGATGYLLKEMDADTLIEAVRIVA
EGGSYLHPKVTHNLIREYRRLTTEKGGAVVKQEVRRPLHLLTRRECEVLQLLADGKSNRA
IGEALYISEKTVKNHVSSILQKLNVNDRTQAVVVAIKNGWVEVR
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacacgcatcgcgattatcgacgatcaccagctgtttcgcgagggcatcaagcgc
attttggaatttgagggcgattttgaagtcgtggcggaaggaagcgacggaagcgaagcg
ctttcgatcgtcgaaacataccgccccgatttggtgctgatggacattaacatgccggac
atcaacggcgttgaggcgacgaaacagctgattgaagcttaccctgatacgaaagtcgtc
gtgctgtcgattcatgacgatgaaaactatgtcatgcgcgccttgcagacgggagcgacc
ggatatttgttgaaggagatggatgccgatacgctcattgaggcggtgagaatcgtcgcg
gaaggcggttcgtacttgcatccgaaagtgacgcacaacttgattcgcgaataccgccgc
ttgacgacagaaaaaggcggcgcagtggttaagcaggaggtgcgccgcccgcttcatttg
ctgacgcggcgcgagtgcgaagtgctgcagctgttggctgacggcaaaagcaaccgcgcc
atcggcgaagcgctttacattagcgaaaaaacggtgaaaaaccacgtcagcagcatcttg
caaaaattaaacgtcaacgaccggacgcaagccgttgtggttgcgatcaaaaacggctgg
gtggaagtgcgctaa

DBGET integrated database retrieval system