KEGG   Geobacillus stearothermophilus: GT50_07620Help
Entry
GT50_07620        CDS       T04043                                 

Definition
(GenBank) transcriptional regulator
Organism
gse  Geobacillus stearothermophilus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LytR_cpsA_psr Sigma_reg_N
Motif
Other DBs
NCBI-ProteinID: ALA70089
UniProt: A0A0K2H7R3
LinkDB All DBs
Position
1429614..1430621
Genome map
AA seq 335 aa AA seqDB search
MNHTRKTVKKRKKKKRLRRFFLLVFLLLLGGVGAFGYNIYSETKQATNKIYQELDPSSKP
ARNIEMRKDPFTVLLVGVENQYHDEEGRSDVVMLLTVNPKTNKVYLLSIPRDTRVYIPSE
GRKDKITHSYSHGGIQSTIAAVNELIDVPIDYYVTTDFEGFEKIVDSLGGVTVDVPFTFK
AQLTGSLKWHTFHKGKQELNGNEALAYVRMRKSDPRGDFGRNERQKQVIRAIIDKSTSIT
SLPKLDDVIADLGDHVRTNIPPSELLSFIYVYQKMKNADVENLHLKGYDETINGVYYYIP
DEQSVSSINETLRQALETSNASLTRSDSPSTQSQN
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatacaagaaaaacggtgaaaaagcgaaagaaaaaaaagcggctccgccgattc
tttttgctcgtgtttcttcttttgctcgggggtgtcggcgcctttggctacaatatttac
tccgagacgaaacaggcaacaaacaaaatttaccaagagcttgatccatcaagcaagcct
gcaagaaatattgaaatgcgcaaagatccgtttaccgtgctgttggttggagtggaaaac
cagtaccacgacgaggaggggcggtctgatgtcgtcatgttgttgaccgtcaatccgaag
acgaacaaagtgtatttgttgagcattccccgcgatacgcgcgtttacattccgagcgaa
gggaggaaagacaaaatcacccactcctacagtcatggaggcattcaatcgacgattgca
gccgtcaatgagctgatcgatgttccgatcgactattacgtgacgacggattttgaaggg
ttcgaaaaaattgtcgattccctaggcggcgtcacggtggatgttccgtttacattcaaa
gctcagctgacaggttcgctcaaatggcatacgttccataaaggcaaacaagagttgaat
ggcaatgaagcgctcgcctatgtgcgcatgagaaaatcggacccccgcggcgattttggc
cgaaacgagcggcaaaagcaagtcattcgcgccattattgacaaaagcacgtccatcacc
tcgttgccgaagctggatgacgtcatcgccgatttaggggatcacgtgcggacgaacatc
cctccgtccgagttgttgtcattcatctacgtctatcaaaaaatgaaaaacgcggatgta
gaaaatttgcatttgaaaggatacgacgaaacgatcaacggcgtgtactactacatcccg
gacgagcaatcggtcagctcaatcaatgaaacgctgcggcaagcgctcgagacgtccaac
gcctccctcacgcgcagcgattcaccatccacacaaagccaaaattaa

DBGET integrated database retrieval system