KEGG   Geobacillus stearothermophilus: GT50_07910Help
Entry
GT50_07910        CDS       T04043                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
gse  Geobacillus stearothermophilus
Pathway
gse00010  Glycolysis / Gluconeogenesis
gse00620  Pyruvate metabolism
gse01100  Metabolic pathways
gse01110  Biosynthesis of secondary metabolites
gse01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GT50_07910
   00620 Pyruvate metabolism
    GT50_07910
Enzymes [BR:gse01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     GT50_07910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: ALA70141
UniProt: A0A0K2H8V8
LinkDB All DBs
Position
1498743..1500263
Genome map
AA seq 506 aa AA seqDB search
MIYAQPGQPGALVTFKKRYENFIGGKWVPPVDGEYFENITPITGQPYCEVPRSKAADIEL
ALDAAHAAKDAWGRTSPAERARLLNKIADRMEENLEMLAVAETWENGKPIRETLAADIPL
AIDHFRYFASCIRAQEGTISEIDHDTVAYHFKEPLGVVGQIIPWNFPILMAAWKLAPALA
AGNCVVLKPAEQTPTSILVLIELIEDLLPPGVVNIVNGFGLEAGKPLASNPRVAKVAFTG
ETTTGRLIMQYASQNIVPVTLELGGKSPNIFFADVMDKDDEFLDKALEGFTMFALNQGEV
CTCPSRALIHESIYDAFMERALERVKQIKQGNPLDTETMIGAQASSEQLEKILSYIDIGK
QEGAELLIGGERNMLEGELAGGYYVKPTIFKGHNKMRIFQEEIFGPVLAVTTFKDHDEAL
SIANETLYGLGAGVWTRDINTAYRFGRGIQAGRVWTNCYHVYPAHAAFGGYKMSGIGRET
HKMMLEHYQQTKNLLVSYSPKKLGLF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgatctacgcacaaccaggccagccaggcgcgcttgtcacatttaaaaagcgctacgaa
aacttcattggcggcaaatgggtgccgccggtcgacggcgagtatttcgaaaatatcacg
ccaatcaccggacagccgtattgcgaagtgccgcgctcaaaagcggcggacatcgaactg
gcgcttgacgccgcccatgcggcaaaagacgcatggggacgcacgtctccagcggagcgc
gcccgtttgctgaacaaaatcgccgatcggatggaagaaaacttggaaatgctggccgtc
gccgaaacgtgggaaaacggcaagccgatccgcgagacgctcgcggctgacattccgctc
gccatcgaccatttccgctatttcgccagctgcatccgcgcgcaagaaggcaccatttcg
gaaatcgatcatgacacggtcgcctatcatttcaaagaaccgctcggcgtcgtcggacaa
atcatcccgtggaacttcccgattttaatggcggcctggaaactcgcgccagcgctcgcg
gccggcaactgcgtcgtgttgaaaccggcggagcaaacgccgacgtcgatcctcgttctc
atcgaactcatcgaagatttgcttccgcctggcgtcgtcaacatcgtcaacggctttggc
ttagaagccggcaagccgctcgcctcgaatccacgcgtggcgaaagtggcgttcaccggt
gaaacgacgaccggacggctcatcatgcagtacgcctcgcaaaacatcgtgccggtcacg
cttgagcttggcggcaagtccccgaacattttcttcgctgatgtgatggacaaagatgac
gagtttctcgataaagccctcgaagggtttacgatgttcgctctaaaccaaggcgaagtg
tgcacatgcccgtcgcgcgccctcatccacgagtcgatttacgatgcctttatggaacgg
gcgcttgaacgcgtcaagcaaatcaagcaaggcaatccgctcgatacggaaacaatgatc
ggcgcccaagcctcgtccgagcaactcgagaaaattttgtcatacatcgacatcggcaaa
caggaaggcgccgaacttttgatcggcggcgaacggaacatgctggaaggggaactcgca
ggcggctattacgtcaagccgacgattttcaaaggacataacaaaatgcgcatcttccaa
gaagaaattttcggcccggtgctcgcggtcacgacgtttaaagatcacgacgaagcgctt
tcgatcgccaatgagacgctgtacggccttggcgccggcgtctggacgcgcgacatcaac
accgcgtaccgcttcggccgcggcatccaagccggccgcgtttggacgaactgctatcac
gtctatccggcccatgcggcatttggcggctacaagatgtccggcatcggccgcgaaacg
cacaaaatgatgcttgagcattaccaacaaacgaaaaacttgctcgtcagctattcgccg
aaaaaacttggcttgttctga

DBGET integrated database retrieval system