KEGG   Geobacillus stearothermophilus: GT50_10635Help
Entry
GT50_10635        CDS       T04043                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
gse  Geobacillus stearothermophilus
Pathway
gse00473  D-Alanine metabolism
gse01100  Metabolic pathways
gse01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gse00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    GT50_10635
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    GT50_10635
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gse01011]
    GT50_10635
Enzymes [BR:gse01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     GT50_10635
Peptidoglycan biosynthesis and degradation proteins [BR:gse01011]
 Precursor biosynthesis
  Racemase
   GT50_10635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ALA70595
UniProt: A0A0K2H977
LinkDB All DBs
Position
1996806..1997960
Genome map
AA seq 384 aa AA seqDB search
MDEFHRDTWVEIDLDAIYDNVANLRRFLPEGTQIMAVVKANAYGHGDAQVAATALEAGAS
RLAVAFLDEALALRKKGIDAPILVLGASRPEDVALAAEHRIALTVFRSDWLEKASSLYNG
STPIHFHLKMDTGMGRLGVKDEEETKRIAALIDRHPPFVLEGVYTHFATADEVNTDYFSY
QYARFLHMLDWLPSRPPLVHCANSAAALRFSDRAFNMVRFGISMYGLAPSPDIKPLLPYE
LKEAFSLHSRLVHVKKLQPGEKVSYGATYTAQTEEWIGTIPIGYADGWLRRLQHFHVLVG
GQRAPIVGRICMDQCMIRLPEPLPVGTKVTLIGRQGDEVISIDDVARHLGTINYEVPCTI
SYRVPRIFFRNKRIMEVRNAVGRG
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggacgagtttcaccgcgatacgtgggtggaaattgatttggacgccatttacgacaac
gtcgcgaatttgcgccgctttttgccggagggtacgcaaattatggccgttgtcaaggcg
aacgcctacgggcacggcgatgcccaagtggcggcaacggcgctcgaagcgggcgcttcc
cgcttggccgtcgcctttttggacgaggcgcttgccttacgaaaaaaaggcatcgatgcc
ccgattttagtgcttggggcgtctcgtcccgaggatgtggcgttggccgccgaacaccgc
atcgccttaaccgtgtttcgctctgattggctcgagaaggcgtcatcgctgtataacggt
tcgaccccgattcatttccatttaaagatggacacgggaatgggacggcttggggtgaaa
gacgaagaggagacaaagcgaatagcggccttgatcgatcgccatccgccctttgtgctt
gaaggagtgtatacgcattttgcgaccgctgatgaagtgaatacggattacttttcttat
caatacgcccgctttttgcatatgcttgactggctgccgtcgcggccgccgctcgttcat
tgcgccaacagcgcggcggcccttcgtttttccgatcgagcgttcaacatggttcgcttt
ggcatttcgatgtacgggctcgccccatcgccggacatcaagccgctcctcccatacgaa
ttgaaagaggcgttttcgctccatagccgccttgtacacgtcaaaaaactgcaaccaggc
gaaaaggtgagctacggtgcgacgtacaccgcgcagacggaagagtggatcggcacgatt
ccaatcggttatgcggacggctggctgcgaaggttgcagcactttcatgtgcttgttggc
gggcagcgggcgccgatcgtcggccgtatctgcatggaccaatgcatgatccgcctgccg
gagccgctgcctgtcgggacgaaggtgacattaattggccgccaaggggacgaagtcatt
tccatcgatgatgtcgcccgccatttgggcacaatcaattatgaagtgccgtgcacgatc
agctaccgggtgccccgtatttttttccgaaataagcgtataatggaagtgagaaacgcc
gttggccgcggatga

DBGET integrated database retrieval system