KEGG   Geobacillus stearothermophilus: GT50_11070Help
Entry
GT50_11070        CDS       T04043                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
gse  Geobacillus stearothermophilus
Pathway
gse00970  Aminoacyl-tRNA biosynthesis
gse01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gse00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    GT50_11070
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:gse03029]
    GT50_11070
Enzymes [BR:gse01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     GT50_11070
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     GT50_11070
Mitochondrial biogenesis [BR:gse03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    GT50_11070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: ALA70657
UniProt: A0A0K2H9D6
LinkDB All DBs
Position
2072864..2073154
Genome map
AA seq 96 aa AA seqDB search
MSRISIEQVKHVADLARLAITDEEAEMFTKQLDAIITFAEQLNELDTENVPPTSHVLDMR
NVMREDIPEPGLPREEVLKNAPDQQDGQFRVPAILE
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgaatttcgattgaacaagtgaaacatgtcgccgatttggcgcggttggcgatt
acggatgaagaggccgagatgtttacgaaacagcttgatgcgattattacgtttgccgag
cagctgaatgaattggacaccgagaacgttccgccgacttcgcacgtgcttgatatgaga
aacgtgatgcgcgaggatattccagaaccggggctgccgcgcgaggaagtgttgaaaaac
gcgccggatcagcaagacggccagttccgtgtgccggccattttagagtaa

DBGET integrated database retrieval system