KEGG   Geobacillus stearothermophilus: GT50_12815Help
Entry
GT50_12815        CDS       T04043                                 

Definition
(GenBank) sodium ABC transporter ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
gse  Geobacillus stearothermophilus
Brite
KEGG Orthology (KO) [BR:gse00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gse02000]
    GT50_12815
Transporters [BR:gse02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter
    GT50_12815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran DUF4162 AAA_21 AAA_23 SbcCD_C AAA_27 AAA_29 MukB
Motif
Other DBs
NCBI-ProteinID: ALA70938
UniProt: A0A0K2HAH1
LinkDB All DBs
Position
2407376..2408275
Genome map
AA seq 299 aa AA seqDB search
MSLEIIEVTKRFGQATAVDHLTLTVPEGEMFGLLGANGAGKTTTFRMILGLLLPTEGVIR
WQGEPIDYSKSHLIGYLPEERGLYPKLKVQEQLLYLGRLRGMKKTDILPEIDRWLERFHI
RDYAHKRVEELSKGNQQKIQFIAAVLHRPKLLILDEPFSGLDPVNVELLKEAVLDLKRNG
TTIVFSSHRMEHVEELCEHVCILRRGRAVVAGALRELKRSFGKQILVIQGDGPFEELARF
PGVLQWKRTAEGVRLQIANEETAQAILGHIAGKVAVRLFALEEPSLNDIFIEKVGAAYE
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgagtttagagatcattgaggtgacgaaacggtttggtcaggcgacggccgtcgaccat
ttgacgttgaccgttccagaaggggagatgttcggattgcttggggcgaacggagcggga
aaaacgacgacctttcgcatgattttaggccttctgctcccgacggaaggggtgatccgt
tggcaaggcgaaccgattgattactcgaaaagccatctgatcggctatttgccggaagag
cgcgggttgtacccgaagctgaaagtgcaagagcagcttctgtatttagggcggttgcgc
ggaatgaaaaagacggatattcttccggaaatcgaccgctggctcgagcgcttccatatc
cgcgattacgcccacaagcgggtggaggagctgtcgaaaggcaaccagcaaaaaatccag
tttatcgctgctgtgcttcatcgaccgaagctattaatcttggatgagccattcagcggt
cttgatccggtgaacgttgaactgttgaaagaagcggtgcttgatttaaaacggaacggc
acgaccattgtcttctcgagtcatcggatggaacatgtggaagagctgtgcgaacatgtc
tgcattttgcgccgcggccgcgcggtggtggctggagcgctgcgtgaactgaaacgttcg
tttggcaaacaaatacttgttattcaaggggacgggccgtttgaagaattggcgcggttt
cctggcgttttgcagtggaagaggacggcggaaggggtgcggctgcaaatcgccaatgag
gagacggcacaagcgatactcggccatatagcaggaaaagtcgcggttcgtctgtttgcc
ttggaagaaccgtctctgaatgatatctttattgaaaaagtaggtgcggcgtatgaataa

DBGET integrated database retrieval system